2checkout integration asp net vb punët

Filtër

Kërkimet e mia të fundit
Filtro sipas:
Buxheti
deri në
deri në
deri në
Lloji
Aftёsitё
Gjuhët
    Shteti i punës
    2,000 2checkout integration asp net vb punët e gjetura, me çmimin EUR

    ...with someone who has ideas of ways we can make the work even better but my main goal is to find someone at this stage who is simply capable of building something what the clients need. 3. I would want to work with someone who has a knowledge of seo and anything else that would enable to give our clients the best chance of their products and services being viewed and therefore used. 4. API integration. 5. An awesome human. I am working hard to move from a single person to an agency set up so to be frank, I need someone who is hardworking, reliable and also that is personable seeing as there would be a fair amount of communication. I’m not a big company so I need someone who gets what I’m trying to achieve and is on a similar wavelength. Lastly, I would want thi...

    €13 / hr (Avg Bid)
    €13 / hr Oferta mesatare
    17 ofertat
    Programing Ka përfunduar left

    Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc

    €11332 (Avg Bid)
    €11332 Oferta mesatare
    4 ofertat
    Crie um Website Ka përfunduar left

    Desenvolvedor .NET MVC, SQL e ADVPL Protheus

    €2752 (Avg Bid)
    €2752 Oferta mesatare
    1 ofertat
    qefqreqweqawdafsc Ka përfunduar left

    asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr

    €185 (Avg Bid)
    €185 Oferta mesatare
    1 ofertat
    yveguwvcjnjnecbkhb Ka përfunduar left

    ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif

    €106 (Avg Bid)
    €106 Oferta mesatare
    1 ofertat

    Hi, the opensource does not support audio playback and export. You need to implement it. Ideal skills and experience for this job include: - Strong proficiency in C# and WPF - Prior experience with FFmpeg integration - Proven track record with audio editing - Good understanding of MP3, WAV, and AAC formats NOTE: We have already extended the project so you will need to guide me to implement the changes you do in this project into our project.

    €142 (Avg Bid)
    €142 Oferta mesatare
    12 ofertat

    I'm seeking a skilled mobile app developer with expertise in Flutter and Firebase integration. The project involves creating a Wishfy lookalike app for both Android and iOS platforms. Key Features: - User Registration & Login: The app should allow users to register and login securely. - Product Browsing & Searching: Implement a user-friendly interface for browsing and searching products. - Wishlist Management: Users should have the ability to create and manage their wishlists. Firebase Integration: - Authentication: Implement Firebase authentication for secure user onboarding. - Firestore Database: Utilize Firestore for efficient data storage and retrieval. The ideal candidate for this project should possess: - Proven experience in developing Flutter apps for...

    €155 (Avg Bid)
    €155 Oferta mesatare
    13 ofertat

    ...Specifically, I'm looking to incorporate Natural Language Processing, Machine Learning Models, and Predictive Analytics functionalities. Key Requirements: - Proven experience in implementing AI features in Power BI is a must. - Strong background in Natural Language Processing, Machine Learning Models, and Predictive Analytics. - Proficient in working with SQL databases and Online APIs for data integration. - Ability to deliver a dashboard with basic filtering and sorting capabilities. Your main tasks will include: - Integrating the AI functionalities into the Power BI project. - Ensuring seamless communication between Power BI and the SQL databases, Online APIs. - Implementing a user-friendly interface with basic filtering and sorting options. If you are confident in your...

    €1689 (Avg Bid)
    €1689 Oferta mesatare
    7 ofertat

    I'm looking to develop a sophisticated software for managing the maintenance and service aspects of my heavy-duty truck fleet. The system should ...and drivers. - Parts Management: An efficient and effective spare parts management module. Ideal Skills and Experience: - Proficiency in developing fleet management systems, specifically for heavy-duty trucks. - Strong background in database management and software integration. - Experience in designing user-friendly interfaces. - Analytical skills for implementing reporting and analytics features. - Ability to create a scalable and robust system. - Prior experience in developing inventory and parts management modules. - Integration to orilink:

    €714 (Avg Bid)
    €714 Oferta mesatare
    75 ofertat

    I'm seeking a proficient freelancer with expertise in Shopify website layout design, menu customization, and third-party app integration. The specifics of this project are: - Revamping the entire layout and design: I'm open to your creative proposals on this to ensure we achieve a visually appealing, user-friendly interface. - Navigation Menu Customization: I require a clean, straightforward, easy-to-use navigation system to facilitate our user experience. - Integration of Third-party Apps/Plugins: Specifically, I need to implement Amazon Dropshipping into my store. Given the urgent nature of this task, I'm looking for someone who can work promptly without sacrificing quality. If you are an expert in Shopify and have experience in eCommerce website developme...

    €57 (Avg Bid)
    €57 Oferta mesatare
    17 ofertat

    I'm looking for an experienced Python developer to take on a complex web development project for me. The primary goal is to build a sophisticated web application with a focus on integrating social media APIs. Key Highlights: - Primary purpose: Web Development - Specific third-party integration: Social Media APIs Key Responsibilities: - Develop a high-quality, responsive web application - Integrate various social media APIs for seamless user experience Ideal Skills and Experience: - Proven track record in Python web development - Strong understanding of social media APIs - Experience in building complex and dynamic web applications - Ability to implement user-friendly interfaces - Understanding of security considerations in web development The successful candidate will have ...

    €196 (Avg Bid)
    €196 Oferta mesatare
    33 ofertat

    I'm in search of a highly skilled Service Now API developer to help me integrate my Service Now platform with external APIs. Key Responsibilities: - Integrate Service Now with selected external APIs - Salesforce, Jira, and Slack - Ensure seamless data flow between the service management system and the external platforms - Develop robust communication and error handling protocols between Service Now and the external APIs The ideal candidate for this project should be well-versed in Service Now API and have a solid track record in integrating with external APIs. Experience with Salesforce, Jira, and Slack APIs is a definite plus. Strong communication and problem-solving skills will be essential for this project.

    €198 (Avg Bid)
    €198 Oferta mesatare
    32 ofertat

    I am in search of a proficient Laravel developer who can help me modify the roles specified as well as integrate an API into my project. The responsibilities for this project will include: - Setting up and integrating the sp...Laravel API - Adapting the roles for Admin, User, and Moderator within the system In addition to this, I would also like to enhance certain features related to users such as: - User registration and login functionalities - User profile management capabilities - User permission management specifications The ideal candidate for this job would be someone with excellent knowledge of Laravel and API integration, role and permission management skills and a solid understanding of user profile management. Previous experience in similar projects would be an added ...

    €159 (Avg Bid)
    €159 Oferta mesatare
    68 ofertat

    Hello, I just need a quick solution to send Whatsapp message using twilio API. In my twilio account, I have already [Whatsapp Business Account ID], [Meta Business Manager ID], [WhatsApp number] That is it. Thank you for your time and look forward to working with you.

    €7 / hr (Avg Bid)
    €7 / hr Oferta mesatare
    13 ofertat

    ...main goal of this website is to attract potential clients. Key Requirements: - Design a visually appealing and user-friendly portfolio website to showcase my work - Implement social media sharing integration, allowing visitors to easily share and promote my content on popular social platforms - Ensure the website is optimized for lead generation and engagement, with a focus on attracting potential clients. Skills and Experience: - Proven experience in website design, particularly portfolio sites - Strong understanding of user experience and interface design - Experience with social media integration and lead generation optimization is a plus - Good understanding of SEO and digital marketing best practices to attract potential clients - Excellent communication skills to u...

    €10 / hr (Avg Bid)
    €10 / hr Oferta mesatare
    45 ofertat

    ...WORDPRESS WEBSITE. - The site should prioritize usability and user engagement, to attract and retain primarily residential homeowners. - It should have a professional and clean design, reflecting the trustworthiness and reliability of our services. - As the main goal is to provide information about our plumbing maintenance services, the site must be well-structured and easy to navigate. - I require integration of an appointment booking system, to make it easy for homeowners to schedule services. - Basic SEO for local search optimization is a plus. Ideal Freelancer: - Proven experience with WordPress website development, especially for service-based businesses. - Familiarity with designing for residential audiences. - Proficient in integrating appointment booking systems. - Kno...

    €162 (Avg Bid)
    €162 Oferta mesatare
    69 ofertat

    ...Elementor for my donation organization. The site should be visually appealing and user-friendly, as we aim to encourage visitors to contribute to our cause. Key Requirements: - Site should be built using Elementor - Design a professional and clean layout that resonates with a charity/donation theme - Integration with PayPal for donations - Implement necessary security measures to protect user data Ideal skills: - Proficient with Elementor, WordPress, and PayPal, VISA, Mastercard and other integration and ALL - Experience in designing and developing donation or e-commerce websites - Ability to deliver high-quality, responsive websites quickly The project is urgent and requires immediate attention, so I'm looking for a developer who can commit to the project and de...

    €469 (Avg Bid)
    €469 Oferta mesatare
    142 ofertat

    I'm in need of a proficient CodeIgniter developer with a solid background in CakePHP. Your primary responsibility will be to set up the project and ensure timely completion. Key functionalities to be implemented include: - User registration and login system - A versatile content management feature - A secure payment gateway integration In addition, creativity is important as I'll need you to develop a clean and responsive design/template for the project. I require daily updates on progress. If you're a skilled, committed developer with a portfolio showcasing your capabilities in full-stack development, I'd love to hear from you. Please bid if you're serious.

    €93 (Avg Bid)
    €93 Oferta mesatare
    32 ofertat

    I'm seeking a seasoned professional to assist me with training a neural network m...fusion with a custom dataset. The work includes: - Understanding the model and its functionalities and writing a Jupyter script for training with a custom data set. - Custom data integration: figuring out the format required by running the example training on text8 dataset and then adapting the in-house dataset for the purpose of training. -Finally, write a custom function which given the trained model enables a spellcheck on masked tokens of the text as in Ideal skills for this project include: - Proven experience in using NLP models and diffusion models. - Proficiency in data integration and model training. -Make the code and implementation accessible to more low-level downstream us...

    €71 (Avg Bid)
    €71 Oferta mesatare
    15 ofertat

    As an ecommerce business, we seek the expertise of an accomplished Angular developer. You will predominantly focus on: - Build...developer. You will predominantly focus on: - Building our frontend, ensuring it's user-friendly and visually engaging. - Pioneering the construction and utilization of Angular components. - Integrating APIs effectively and efficiently into our platform. Your skills and experience should include: - Proven expertise in Angular development and component creation. - Demonstratable prowess in API integration. - Specific experience in ecommerce sector would be beneficial. We anticipate a partnership that will improve our user interface, thus growing the business. The perfect candidate will be an experienced Angular developer with a passion for the ec...

    €45 (Avg Bid)
    €45 Oferta mesatare
    15 ofertat

    ...develop a landing page for my yoga classes. The landing page should be visually appealing and highly functional to increase sales and registrations for my classes. Key requirements: - Aesthetic: The page should feature a serene blue color scheme to match the tranquility of my yoga classes. Your design skills should reflect in creating an appealing interface that resonates with users. - Payment Integration: Paytm should be integrated for payment processing. You should have prior experience in integrating payment gateways and ensuring user data security. - Functionalities: The page should enable online class registration and display the class schedule. Alongside, it should have a testimonials section where clients can share their experiences. Experience in designing and implem...

    €43 (Avg Bid)
    €43 Oferta mesatare
    33 ofertat

    I have a current project built using CodeIgniter 3 and I'm looking for someone to upgrade it to CodeIgniter 4. - The upgrade should cover all necessary functionalities such as user authentication, database management, and API integration. - I need someone experienced in CodeIgniter, with a strong grasp of both versions, to ensure a smooth transition. - Since there are third-party libraries and plugins used in the current project, it's crucial that these are taken into account during the upgrade process. Please provide your experience and examples of prior similar projects in your application. A detailed plan on how you intend to approach this upgrade would also be appreciated.

    €91 (Avg Bid)
    €91 Oferta mesatare
    13 ofertat

    ...available rooms with text that we can customize. I already have a specific message that I want to send out. I don't have a preferred platform or language for the script, so I am open to suggestions. Ideal skills and experience for the job: - Proficiency in Python or JavaScript - Experience in creating scripts for bulk messaging - Ability to customize the messaging content - Familiarity with website integration and messaging APIs Here's a video of the website and what's needed, please watch this and bid. It's a simple script but I don't have the time to make this so please bid I dont want python unless you can provide me 2 years warranty and i want you to explain how it will work I have a budget

    €172 (Avg Bid)
    €172 Oferta mesatare
    36 ofertat

    I need assistance in setting up an Azure Redis Cache to enable quick data access for my distributed systems. Key Requirements: - A thorough understanding of Azure Redis Cache setup, particularly in a private endpoint configuration. - Proficiency in Java for integration with the Redis Cache. - Ability to ensure the cache is optimized for data access. It's essential that the setup is secure and efficient, ensuring the data access is quick and reliable for my distributed systems. Your expertise in this area will be valued greatly.

    €8 / hr (Avg Bid)
    €8 / hr Oferta mesatare
    5 ofertat

    I'm looking for a skilled PHP developer to help me with my modern and sleek jewellery site. Key Requirements:...Registration & Login: To enhance user experience, the site should allow users to create accounts, log in, and manage their profiles. This is essential for tracking orders, providing personalized recommendations, and more. Ideal Skills & Experience: - Proficiency in PHP development, with a strong understanding of creating and maintaining e-commerce sites. - Experience with database management and integration. - Knowledge of front-end technologies for creating a modern, sleek, and responsive design. - Ability to work collaboratively and communicate effectively. If you have a keen eye for design, a passion for e-commerce, and a knack for problem-solving, I&#...

    €259 (Avg Bid)
    €259 Oferta mesatare
    55 ofertat

    I'm looking to develop a 4-tier agency commission calculation system that hinges on the daily NAV (Net Asset Value) of the assets. The system should have the following key features: - **Tiered Commission Structure:** The system must support a 4-tier commission structure. These tiers should be clearly defined and adjustable by an administrator. - **Daily NAV Calculation:** The daily NAV should be calculated based on historical data. This data should be accurate and reliable, and the calculations should be precise. - **Automation:** The system should automatically trigger commission calculations at the end of each business day. This ensures that the process is efficient and error-free. The ideal freelancer for this project should have: - Proficiency in designing and develop...

    €88 (Avg Bid)
    €88 Oferta mesatare
    10 ofertat

    I am currently in the need of a professional who can set up a business email account for my new website using Outlook. Key Requirements: - Experience in setting up business email accounts on Outlook. - Familiar with domain integration. - Can assure a standard security level for the account. Please note, I already have a purchased domain for the business email. You are expected to promptly align this task within the given requirements. The right candidate should have the experience and skills to carry out this task efficiently.

    €14 (Avg Bid)
    €14 Oferta mesatare
    3 ofertat

    Maintenance of Shopify carrier integration

    €56 / hr (Avg Bid)
    €56 / hr Oferta mesatare
    1 ofertat

    I am currently in the need of a professional who can set up a business email account for my new website using Outlook. Key Requirements: - Experience in setting up business email accounts on Outlook. - Familiar with domain integration. - Can assure a standard security level for the account. Please note, I already have a purchased domain for the business email. You are expected to promptly align this task within the given requirements. The right candidate should have the experience and skills to carry out this task efficiently.

    €18 (Avg Bid)
    €18 Oferta mesatare
    2 ofertat

    I'm looking for a skilled developer to build an e-commerce website for me using Shopify as the platform. The main requirement for this project is to integrate a payment gateway into the site. Key requirements: - Develop a fully functional e-commerce site using Shopify - Implement a secure and efficient payment gateway system Ideal Skills: - Proficient in Shopify development - Experience in integrating payment gateways - Strong understanding of e-commerce best practices - Attention to detail and quality assurance If you have previous experience with similar projects, I'd love to hear from you. Please provide examples of your previous work and an estimated timeline for completion.

    €438 (Avg Bid)
    €438 Oferta mesatare
    111 ofertat

    Looking f...Components: - Designing intuitive and efficient user interfaces. - Developing custom functionalities as per the project's requirements. - Implementing data integration for seamless information flow. While the main purpose behind this project hasn't been detailed out, the chosen tasks indicate it would greatly aid in streamlining processes or improving data management. Hence, the project might have leanings towards enhancing the efficiency of business operations. Ideal Candidate: - Proficient in designing UI for OUAF. - Track-record in performing custom functionality development. - Proven skills in implementing data integration on OUAF. - Availability to start immediately. Your prompt application is highly appreciated considering the time-sensit...

    €13 / hr (Avg Bid)
    €13 / hr Oferta mesatare
    4 ofertat

    I need an experienced developer to incorporate a "to-do" function within an existing iOS and Android Firebase chat application. The requirements are as follows: - Must work seamlessly on both iOS and Android platforms. - A design for the feature has already been prepared, which needs to be precisely implemented. - The feature should enable users to add and manage single tasks. The ideal candidate should have experience with Firebase, iOS and Android development, and a history of integrating new features into existing apps. Understanding user interface design would be a plus, to accurately implement the planned design.

    €601 (Avg Bid)
    €601 Oferta mesatare
    102 ofertat

    I'm in need of...application. The primary goal of this app is to facilitate the sales of products. Key Features: - E-commerce Functionality: This app should be designed to allow users to easily browse and purchase products through a user-friendly interface. - Payment Integration: The app should be integrated with PayPal and Credit/Debit Card processing for seamless and secure transactions. The ideal candidate for this project should have: - Proven experience in Android app development, particularly in e-commerce. - Strong understanding of payment integration systems, especially with PayPal and Credit/Debit Cards. - A portfolio demonstrating past successful e-commerce app projects. If you are confident in your ability to deliver on these requirements, I look forward ...

    €4179 (Avg Bid)
    €4179 Oferta mesatare
    47 ofertat

    I am looking for a skilled Android developer to create an eCommerce app. This app will have the ability to process payments via credit cards and feature user accounts for simple login purposes. Key requirements: - Develop an Android eCommerce app - Integrate credit card payment functionality - Implement user accounts with simple login Ideal skills and experience: - Proficient in Android a...experience: - Proficient in Android app development - Experience with eCommerce app development - Knowledge of integrating credit card payment gateways - Familiar with user account management in apps - Prior experience in creating secure, user-friendly apps In your bid, please include examples of your previous eCommerce app work and any relevant experience you have with credit card payment integr...

    €763 (Avg Bid)
    €763 Oferta mesatare
    69 ofertat

    ...agreed mutually Budget? will not be disclosed, place your best bid to get considered Payment? - you estimate in a WBS (optimistic, expected, pessimistic, where optimistic < expected < pessimistic) after getting the task - we discuss about clearances and effort - we mutually agree to effort - we assign you the task after mutually agreed - you implement, test and deliver - you provide also unit /integration tests to ensure code is always working - you document each required step to make interaction of systems to work - we test on our premise (you maybe help to fix issues) - we pay (basically the rules of freelancer) Closed book vs open book? We work only on open book. Closed book means you are unwilling to define a WBS for the work and you add only a price tag to the tas...

    €124 (Avg Bid)
    €124 Oferta mesatare
    15 ofertat

    I need a total overhaul of my website, which is currently outdated in its design. I am aiming for a bold, colorful, and engaging layout that is sure to catch visitors' attention. While I don't have specific colors in mind, I am open to creative suggestions on incorporating various appealing color schemes that can enhance user experience. Key Features: - Modernized, bold and co...colors in mind, I am open to creative suggestions on incorporating various appealing color schemes that can enhance user experience. Key Features: - Modernized, bold and colorful website design - Enhanced UX and higher conversion rates Ideal candidate would have: - Experience in web development and designing - Expertise in UI/UX - Strong grasp of color theory - Innovative approach to color integr...

    €285 (Avg Bid)
    €285 Oferta mesatare
    79 ofertat

    I'm looking for a skilled developer to build an e-commerce website for me using Shopify as the platform. The main requirement for this project is to integrate a payment gateway into the site. Key requirements: - Develop a fully functional e-commerce site using Shopify - Implement a secure and efficient payment gateway system Ideal Skills: - Proficient in Shopify development - Experience in integrating payment gateways - Strong understanding of e-commerce best practices - Attention to detail and quality assurance If you have previous experience with similar projects, I'd love to hear from you. Please provide examples of your previous work and an estimated timeline for completion.

    €486 (Avg Bid)
    €486 Oferta mesatare
    145 ofertat

    ...increase conversion rates. Key Requirements: - Product Customization: We need to integrate options for product customization on our platform. This is essential to cater to our B2B target audience. - Efficient Inventory Management: Adequate inventory management is crucial to ensure seamless order processing. A Shopify expert who can streamline this process is highly desired. - Payment Gateway Integration: We are looking to integrate a variety of payment gateways to ensure a smooth transaction process for our customers. Ideal Skills and Experience: - Extensive experience with Shopify development, particularly in the area of website redesigns. - Strong understanding of e-commerce and B2B website requirements. - Proven track record of improving user experience and conversion rates...

    €16 / hr (Avg Bid)
    €16 / hr Oferta mesatare
    53 ofertat

    I'm looking for a skilled image editor with experience in architecture visualizations. The task involves editing a set of images for realistic view settings and highly detailed environmental integration. Key Skills and Experience: - Proficiency with image editing software - Demonstrable experience in architecture image editing - Prior work with environmental integration - Strong attention to detail and realism The main objectives: - Create a realistic view setting for the architecture images - Ensure the visualization enhancements are highly detailed, incorporating environmental elements in a seamless manner. The purpose of these images will be for presentation/visualizations, so it's crucial that the final product is polished, realistic, and artistically sound...

    €49 (Avg Bid)
    €49 Oferta mesatare
    9 ofertat

    I need an adept freelancer who can efficiently assist with workflow automation. Their features and capabilities should be second-nature to them, to tackle custom tasks at any level. Key Responsibilities: - Create, fine-tune and manage workflow automation on Ideal Candidate: - Be an expert in workflow automation on - Have ability ...automation. Their features and capabilities should be second-nature to them, to tackle custom tasks at any level. Key Responsibilities: - Create, fine-tune and manage workflow automation on Ideal Candidate: - Be an expert in workflow automation on - Have ability to respond and work quickly - the project needs to be completed ASAP Note: This does not involve any external tool integration, only Monday.com.

    €302 (Avg Bid)
    €302 Oferta mesatare
    20 ofertat

    ...expert ability to seamlessly combine front-end and back-end capacities will be crucial to the success of this project. The project encompases 3+ websites, new logo design, testing, and hosting capabilities. Key Requirements: - Mastery of Wordpress or similar. - A minimum of 5 years experience in full stack development. - Expert in UX/UI. - Integration of chat function. - Integration of ticketing system. - Integration of chat function. - Integration of advertising banner function. - A proven record in deploying and maintaining functional, secure and high-quality applications. - Experience in building a forum or blog. Ideal candidates should detail their extensive experience with similar projects. Please highlight any accolades, milestone achievements, or p...

    €36 / hr (Avg Bid)
    €36 / hr Oferta mesatare
    108 ofertat

    ...freelance developer adept at building and managing a Shopify e-commerce platform from beginning to end. This encompasses: 1. **Website Creation**: I need to have a custom, fully functional, user-friendly, and visually pleasing design. 2. **Deployment**: I require someone with experience in efficient website launching processes and managing all technical aspects. 3. **Publishing**: Seamless integration with my inventory for product listing and publishing is vital. 4. **Marketing**: The ideal candidate has expertise in marketing strategies focused on driving traffic to the site and increasing conversions. Ideally, the right fit for this project has extensive Shopify expertise, strong design instincts, and a background in e-commerce. They should understand online consumer...

    €123 (Avg Bid)
    €123 Oferta mesatare
    56 ofertat

    For this project, I'm seeking a skilled professional who is proficient at integrating composite animation videos. You'll need to be able to: - Generate an animation video with a file ported using Unity Unreal Exe. - Export the video as an mp4. - Complete the job ASAP. - Include these: 1 PLM 2 AI report 3 AI Foreman 4 QA 5 Safety 6 Collaboration with each in less than 10 seconds, you should add these 6 features to the video sequence, by creating a foreman, producing an ai report via chatgpt etc. So the total time would be less than 1 minute 30 seconds. Ideal skills and experience: - Proficiency in Unity Unreal Exe. - Familiarity with Windows mp4 format. - Attention to detail and excellent time management skills. The deadline is a high priority for this project, so please on...

    €114 (Avg Bid)
    €114 Oferta mesatare
    29 ofertat

    ...token and NFT generator tool that can be compatible with various blockchain platforms. The tool should allow me to create, manage, and distribute different types of tokens including utility tokens, security tokens, collectible tokens, and NFTs. I need the following features to be incorporated in the tool: - Customizable token name and symbol. - Ability to set token supply and decimals. - Integration with a range of blockchain platforms (Ethereum, Binance Smart Chain, BASE, POLIGON, FANTOM, ARBITRUM, OPTIMISM, AVALANCHE AND SOLANA, RELATIVES TESTNETS). - Capability to create a liquidity pool. Ideally, you should have: - Advanced knowledge and experience with blockchain technology and token creation. - Proficiency in working with multiple blockchain platforms. - Previous exper...

    €709 (Avg Bid)
    €709 Oferta mesatare
    58 ofertat

    I'm in need of a proficient mobile app developer with a strong understanding of both iOS and Android platforms. Key functionalities to include: - Integration with Google, Apple, and Facebook for seamless login experience. The ideal candidate should have: - Previous experience in creating and integrating social media logins on a mobile app. - Proven expertise in both iOS and Android app development. - Experience with e-commerce features would be a bonus. The end goal is to create a user-friendly app with easy social interaction capabilities, including secure login options through popular social media platforms. Your specialist knowledge will be pivotal in achieving this.

    €304 (Avg Bid)
    €304 Oferta mesatare
    46 ofertat

    Need C# developer to integrate zatca and below actions, Please contact if you have previous experience in zatca einvoice integration. Prefer to develop a rest Api to call zatca and input parameter will provide invoice in Json. Anyone has previous experience on zatca integration is preferred, we need to complete as soon as possible. 1. Create CSR certificate 2. Compliance Invoice with simulation and production 3. Clear Invoice with simulation and production 4. Report Invoice with simulation and production Note: We need source code, and it should be configured on our system.

    €1176 (Avg Bid)
    €1176 Oferta mesatare
    15 ofertat

    I will not respond to generic responses. I have a Wordpress website that I need information added to. I also want all the information moved into a new shopify website as well. I have a scrape with information and part numbers that will cross over to some of my existing listings. I need all this information added to my Wordpress website and then the left over listings from the scrape also added to my Wordpress and shopify websites without a price. I also need some minor adjustments made to the descriptions on the Wordpress website for seo purposes. I currently have approximately 3000 lines on my Wordpress site and the scrape has 20000 lines.

    €101 (Avg Bid)
    €101 Oferta mesatare
    129 ofertat

    I need ...that has comprehensive details on each item. - Shopping cart functionality that allows users to add and manage items they wish to purchase. - User registration and login mechanisms to enable easy sign-up and returning customer access. - A product search feature for quick item locating. - Product filtering to allow users to narrow down their search based on specific criteria. - A payment gateway integration for seamless and secure online transactions. Ideal freelancers for this job should have: - Proficiency in WordPress, with experience in creating e-commerce sites. - Strong understanding of UX/UI design to ensure the website is user-friendly. - Familiarity with integrating payment gateways. - Ability to replicate the mentioned functionalities from the reference website a...

    €313 (Avg Bid)
    €313 Oferta mesatare
    121 ofertat
    Flutter App Developer with GraphQL 6 ditë left
    VERIFIKUAR

    ...in integrating GraphQL. The project involves building a customer-centric app compatible with iOS, Android, and Web platforms. Your primary tasks will include implementing a Model-View-Controller (MVC) structure, ensuring smooth user authentication, push notification, and in-app purchase features. Key Requirements: - Proficiency in Flutter and its ecosystem - Proven experience with GraphQL integration - Ability to develop custom UI/UX designs - Understanding of MVC architecture and its implementation in Flutter - Previous experience with user authentication, push notifications, and in-app purchases Your previous work should demonstrate your ability to create efficient, bug-free, and user-friendly apps. The ideal candidate will be a proactive problem-solver, able to work indepen...

    €7 / hr (Avg Bid)
    €7 / hr Oferta mesatare
    33 ofertat

    I'm in need of a skilled web developer to create a website for my new car dealership. The website will include a comprehensive set of features to ensure a smooth and user-friendly experience. Key Features: - Advanced Search Filters: Enable users to easily find their desired car based on various criteria such as make, model, year, price, etc. - Online Payment Integration: Implement a secure and reliable payment gateway for seamless transactions. - User Reviews and Ratings: Allow customers to leave feedback and rate their purchase experience, enhancing the credibility of the platform. Vehicle Listings: The website will exclusively list new cars. Therefore, it's essential to focus on showcasing these vehicles effectively. News Section: Additionally, I'm interested i...

    €378 (Avg Bid)
    €378 Oferta mesatare
    67 ofertat