3d models vb net punët
I need a 3D model of something. Ndertoni llogarin e perdoruesit user1
I need a 3D model of something. Ndertoni llogarin e perdoruesit user1
Translate Albania-English Te ket liqen 3d te ket vetura palma gjdo gjë qe kan fshataret qo me thon farming
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
...developer who could significantly improve an existing Android application built on .NET with SQL backend. Major tasks include: - Redesigning UI/UX to make the app more intuitive and user-friendly - Adding more interactive elements to keep users engaged - Improving navigation for a flawless user experience - Identification and fixing of bugs, coupled with performance optimizations for a smooth application flow - Integration of new features such as push notifications, in-app messaging, and creation of 'Course Sections', Course Notes Section - Reworking of the 'Find Jobs' section to make it more efficient - And with complete new Login and Sign pages. Ideal freelancer should have: - Extensive experience with .NET, SQL, and Android app development - Pr...
...seeking a talented designer who can create a 3D logo featuring an opal gemstone, complete with distinctive light reflections, vivid opalescent colors, and a specific gemstone shape. The design must embody a modern aesthetic, using fresh, bold elements to capture the beauty and allure of the gemstone. With colorful smoke around it. Shown like in the attached photo but with more vivid color and a different opal Key requirements include: - Advanced 3D graphics skills - Proficiency in creating modern designs - Experience in logo design The logo will be prominently used on my website and social media profiles. It should be versatile and adaptable, displaying well across various platforms and screen sizes. If you have previous work involving gemstones or 3D design, ple...
Hello, We are looking for an experienced .NET/Visual Basic developer to update the current Desktop application for dental service. The application connects to EHR to extract data. We need someone who can help with improving the application and maintaining in a long-term basis. Requirements - Visual Basic/VB.NET (10/10) - Desktop & Web Application Development - Experience in EHR, Healthcare Software - Available to fully work in the US time zone (EDT or CDT) - High level of English - Individual freelancer only (No Agencies) Pls apply with your CV. I look forward to hearing from you. Thank you
For my project, I am seeking a talented animator who can breathe life into my household product, a radio. The animation required is a 360-degree view showcasing the overall look of the product. Key details include: - General Dimension: No need for specific measurements - a rough dimension is acceptable. Focus on the proportio...acceptable. Focus on the proportions to represent the product realistically. - Moderate Detail: The animation should show the main parts but doesn't need to get into intricate details. Concentrate on the distinguishing features that set the product apart. The ideal freelancer for this project would have some prior experience with product animation and a flair for artistic realism. Expertise in 3D animation and understanding of household products will...
...o Critically evaluate the limitations of the Black-Scholes model, including its assumptions of constant volatility and interest rates, and the inability to accurately price American options. o Discuss the real-world implications of these limitations and how they affect the model's accuracy and reliability. 5. Alternative Models and Advances o Explore alternative models developed to address the limitations of the Black Scholes model. Compare and contrast these models in terms of their assumptions, applicability, and accuracy. 6. Practical Applications and Case Studies o Present practical applications of the Black-Scholes model in current financial markets. Include case studies where the model has been applied in option pricing, risk management, or financ...
...customer first and takes the time to ensure the solution is done right the first time A curious and persistent learner who constantly seeks new and better ways to solve problems 5+ years professional software development experience including the delivery of high-availability, scalable cloud software A passion for strongly typed, object-oriented languages like C#, Java, or similar Experience with .Net Core, SQL, NuGet, Git, and Azure DevOps is a plus Experience writing and maintaining serverless cloud solutions is a plus Must pass a Criminal Justice Information Services (CJIS) background check and maintain confidential and highly sensitive information. Application Process: To apply, please attach your resume and provide a link to your GitHub profile showcasing relevant projects o...
This is job is only available for the of Bangladesh.. We are seeking a talented freelance web designer/developer to create a custom template for our existing website, Whi...the of Bangladesh.. We are seeking a talented freelance web designer/developer to create a custom template for our existing website, While we admire the design and layout of , we are looking for a unique template that aligns with our brand identity and specific requirements. We need Following templates to be design in our site: Home Engagement Models Solutions Expertise Technology Expertise All Technologies All Software Developers Developer Skill Recruitment Clients About Contact Outsourcing Handbook Why Outsource Why Nearshore Insights
Having plans to streamline our business processes, I'm in need of a proficient expert in ERPNext and Odoo. The professional should possess the following skills and experience: - We are interested in migrating to Odoo or erpnext open source and have several requirements: 1)We need to customize their database to suit our needs. 2)We are open to developing additional models as required. 3)We expect you to create APIs, or we can provide them for both push and pull functions. 4)Customizing reports according to our specifications is essential. 5)We will provide APIs with formulas for implementation either in the database or within the API itself for display purposes. If feasible, we are open to freelance or part-time arrangements. Please provide your expectations.
I'm a registered civil & structural engineer with a ranch in South Texas. I require a skilled architectural designer proficient in AutoCAD (may be an architect, architectural student, or seasoned architectural designer) to take on the task of refining my barndominium residential building design. The design in its current state is a... and plumbing designs. An architectural designer with skills and experience in residential design and working with draft designs would be most suitable for this project. Your expertise in modern-rustic style homes, understanding of structural integrity and passion for creating warm, inviting spaces would be appreciated. Fluency in AutoCAD is a must with a preference for someone familiar with 3D modeling for interior and exterior displays ...
I have various STL files that I have designed, but I am having issues making sure all the modules fit perfectly. Upon Looking into why, my individual assets are slightly misaligned leading to why i can not fit the finished project together. I am looking for a 3D modeler to clean up my STL files and confirm that they will slot perfectly into each module for my buildings.
Hi, As discussed I am ready to do this panel 3d design and provide 5 patterns that are in a golf simulator like the example. Hexagon, Diamond, Square, Weave, Elevate. Quality of work will be realistic professional for sure Please accept my quote Thanks Avtar
I need a robust Unity 3D developer to refine the existing rendering tool used by our company. We're not looking for an overhaul but specifically towards impactful enhancements. Key Improvements Required: - Improved User Interface - Integration of New Features - Performance Optimizations Desired Additional Features: - Capability for Real-time Preview - Customizable Lighting Effects - Superior Material Editor The key industry of application is Architecture. Looking for developers with exceptional skill and experience in Unity 3D, user interface design, and graphics programming. An understanding of architectural visualization would further strengthen your application. Your contribution will turn our rendering tool into the advanced, user-friendly tool our users w...
...suggestions - although that is a part of it. The integrated AI model I want should take care of design, cut, and even print of the apparel, providing a truly personal and dynamic shopping experience for users. I already have an AI model in mind for this project. The ideal freelancer for this project would have: - Robust experience in website development and design - Specific expertise implementing AI models into websites - Prior experience or understanding in the fashion or apparel industry is advantageous - Problem-solving skills and ability to work creatively This project will stand out in your portfolio due to its innovative and exciting nature. I look forward to seeing your proposal....
I'm looking for an experienced 3D modeler to create a comprehensive model of a smoke generator, a crucial component in fire safety devices. Key details you need to know: * This project focuses exclusively on product modeling, specifically heavy on detailing and perspective. * I'm particularly interested in professionals who have prior experience with modeling fire safety equipment, though it's not an absolute requirement. Ideal skills and expertise: * Expertise in 3D modeling software such as AutoCAD, SketchUp or similar. * Experience in product modeling, especially technical and industrial equipment. * Knowledge in fire safety devices is a plus. * Strong attention to detail is crucial. Please ensure you provide relevant examples of previous work in your ...
I need someone with proficiency in 3D AutoCAD who can replicate complex metal products such as electrical utilities, light brackets, and cabinets. These designs will be used for both manufacturing and product promotion. Key requirements include: - High accuracy in detailing intricate designs. - Exceptional skills in 3D AutoCAD with an emphasis on product design. - Extensive experience in the design and representation of metallic objects. - Ability to visualize complex structures and render them fully in 3D. The ideal person for the job should have a strong background in metallurgy, fabrication, or a related field. By implying practical knowledge into the designs, bidders can provide innovative and feasible solutions while maintaining high visual accuracy and dimensi...
...Case Overview: The primary business case for developing this WordPress-based platform is establishing a centralized hub that showcases my expertise in technology with a specific focus on healthcare, driving business growth through increased visibility and engagement in this sector. The platform will serve as a digital beacon in the tech industry, highlighting my unique approach to integrating AI and 3D design in web development and project management, mainly as these technologies apply to healthcare. Core Business Concepts: - Expertise Showcase: The system must effectively present my extensive knowledge and experience in AI-enhanced solutions and interactive UX/UI, establishing myself as a leader in these domains, particularly within healthcare. - Engagement and Conversion: The ...
...seeking a talented designer who can create a 3D logo featuring an opal gemstone, complete with distinctive light reflections, vivid opalescent colors, and a specific gemstone shape. The design must embody a modern aesthetic, using fresh, bold elements to capture the beauty and allure of the gemstone. With colorful smoke around it. Shown like in the attached photo but with more vivid color and a different opal Key requirements include: - Advanced 3D graphics skills - Proficiency in creating modern designs - Experience in logo design The logo will be prominently used on my website and social media profiles. It should be versatile and adaptable, displaying well across various platforms and screen sizes. If you have previous work involving gemstones or 3D design, pl...
...seeking a talented designer who can create a 3D logo featuring an opal gemstone, complete with distinctive light reflections, vivid opalescent colors, and a specific gemstone shape. The design must embody a modern aesthetic, using fresh, bold elements to capture the beauty and allure of the gemstone. With colorful smoke around it. Shown like in the attached photo but with more vivid color and a different opal Key requirements include: - Advanced 3D graphics skills - Proficiency in creating modern designs - Experience in logo design The logo will be prominently used on my website and social media profiles. It should be versatile and adaptable, displaying well across various platforms and screen sizes. If you have previous work involving gemstones or 3D design, pl...
...parezca a las otras paginas y no afecte el seo. 3 - una vez creada el equipo Seo nos indicara la informacion a modificar en base a seo on page y topic cluster. 4- sobre la pagina web ingresaremos las seccion de sillas y mesas. Pero la seccion mas importante sera la de los camarotes y camas. Fotos que tendrán que estar sin logo y renderizarlas para poder dar una experiencia 3D a los clientes. 5- Como el objetivo de esta e-comers es el posicionamiento Seo. Se considerara la herramienta que se use en Wordpress mas idonea para facilitar el Seo. 6- es inportante recalcar que las paginas en función de las cuales vamos a crear esta nueva. Son oaginas que también estaran en proceso de optimización Seo por lo cual es de vital importancia que la informa...
I am searching for an expert in kitchen design who can utilize their skills to provide me with ...incorporating drawers wherever feasible - Color scheme should be neutral (white, gray, beige) Skills and Experience: - Expertise in both 2D and 3D kitchen design - Familiarity with modern design concepts - Ability to provide renderings - Proven experience in space utilization and cabinetry design. Current space is separated by wall between dining room and kitchen. Would like to combine both spaces, removing the wall. Current kitchen space has 4 doors and loses a lot of possible countertop space. The dining room has 2 doors only and less windows which could make it easier to optimize. I look forward to your creative designs. Need 2d plans and 3d model and render, after 2d pla...
I'm seeking a skilled 3D video designer to create a modern and sleek promotional video for our state-of-the-art LED lights designed specifically for tennis courts. Key Features to Highlight • Brightness: Convey how our LED lights outshine conventional lighting solutions, providing optimal illumination for evening games. • Energy Efficiency: Illustrate the superior power-efficiency of our LED technology, emphasising how it leads to significant energy savings. • Durability: Showcase the robust longevity of our lighting solution, enduring harsh weather conditions and providing reliable durability for years. Ideal Skills and Experience • Proficiency in 3D modeling and video editing software • Prior experience in product promoting videos • Und...
We have a digital marketing agency and I am looking for a few fresher models to create some videos for our brand. These videos will be recorded and sent by you, our team will edit and publish them on our social channels. We are willing to pay hourly for this, no specialization needed, just anyone with good camera and confidence to record would do. Thank You
Engaging a dedicated and experienced freelancer to partner with me in the exciting "Image Matching Challenge 2024 – Hexathlon challenges" by Kaggle. YOUR ROLE: - You'll be contributing your Machine Learning expertise for the coding and deployment of the models. MY ROLE: - As for me, I'll cover the other areas of the project aligning with my skills. REQUIREMENTS & EXPERIENCE: - Have previously participated in Kaggle challenges - Strong expertise in Machine Learning - Ability to work well as a part of a team This is a great opportunity to exercise your Machine Learning skills and contribute to challenging Kaggle competitions. Let's tackle this challenge together! No budget for this challenge, wanted to just participate.
...for solvent selection (compatibility with biomaterials, toxicity, evaporation rate, etc.) - Types of solvents used in scaffold fabrication (water-based, organic solvents, supercritical fluids, etc.) - Effects of solvents on scaffold properties (morphology, porosity, mechanical strength, etc.) 5. Fabrication Techniques - Overview of scaffold fabrication techniques (electrospinning, freeze-drying, 3D printing, etc.) - Detailed explanation of selected fabrication techniques - Advantages and limitations of each technique - Influence of fabrication parameters on scaffold properties (temperature, pressure, concentration, etc.) 6. Scaffold Properties - Morphology of scaffolds (porosity, pore size distribution, surface area, etc.) - Mechanical properties (elastic modulus, compressive s...
...understanding of several key concepts that form the backbone of my studies. - The key subjects of focus are Statistics and Probability. - Moreover, the distinct concerns within these subjects include the following: - Mean, Median and Mode - Probability Distributions - Hypothesis Testing - Linear Sparse Model - Large Inverse Covariance Matrices - Sparse Vector Auto Regressive Models - Concentration Bounds The ideal candidate should have advanced knowledge in these areas, and preferably experience in tutoring at a postgraduate level. An ability to impart knowledge effectively and deliver valuable input and guidance on academic projects is highly sought after. A strong academic background in mathematics, especially with a focus on statistics and pro...
I need an accomplished 3D artist proficient in rendering highly detailed glass liquor bottles. The renderings will primarily be used for product design approval. It's essential that the artist can recreate the intricate characteristics of glass realistically, capturing the prismatic effects and high resolution details that bring out the aesthetic qualities of the bottles. Images and mock ups will be provided for reference, would also like to speak throughout the process to ensure the specs are what is needed. Experience in similar projects is highly desired. The bottle is going to have to adhere to certain specifications - ( it is a liquor bottle ) and will have a hammered glass / rippled glass texture throughout the bottle. But on areas of the glass where the paper label wil...
Tengo un mecanismo en catia. Para que funcione tengo que utilizar un resorte en la vida real teniendo en cuenta el resorte necesito que mi archivo catia sea funcional e imprimible en 3D.
Zlecimy wykonanie modelu 3D maskotki firmowej - Świstaka. Wymagane pliki produkcyjne oraz rendery.
Hello! I am currently searching for professionals who specialize in hard surface modeling, specifically for vehicles. As per the project requirements, i will share concept with you personally once designer is slelected . budget is negotiable and can be discuss please mention your portfolio links in your proposal Regards
Basically there are 2 tasks: - For task 1, I need the 2D coordinates (elevation profile) of a 3D model of a tree bark. - For task 2, I need you to create a new 3D model by merging 2 existing 3D models that I will provide (a tree bark model and a plate model) Precision here is key; I require a high-detail design to fully bring out small-scale features of the bark. The final 3D model will be printed in plastic. Ideal Skills: * Proficiency in GIS software/or other slicing softwares capable to generate elevation profile from a 3D model (e.g., 3DFLOW) (to accurately get and translate the 2D elevation data). * Extensive experience in 3D modelling, specially in building and merging parts for 3D printing. * Close attention to miniature det...
...purpose of this dashboard is for monitoring project progress, tracking team performance, and analyzing code quality. It’s important that the functionality and integrity of these features are maintained in the migration to Laravel. The current codebase falls under the category of 'small', with less than 10,000 lines of code, consisting primarily of CRUD operations. For context, the main entities/data models involved in these CRUD operations are Users, Products, and Orders. Skills and experience necessary: - Proficiency with PHP and Laravel framework - Experience migrating from CI to Laravel - Familiarity with CRUD operations and MVC architecture - Understanding of database schema related to Users, Products, and Orders You should ensure that the converted Laravel...
I am urgently seeking an experienced Python expert specialized in data science, in particular large language models and Generated AI. Your task will revolve solely around machine learning modeling. Your responsibilities will include: - Implementing unsupervised machine learning to produce effective anomaly detection models. It's essential that you: - Have significant experience with Python, large language model, and general AI - Hold solid understanding of unsupervised machine learning and anomaly detection - Are able to work independently, as this project is unsuitable for those currently committed to full-time employment. This opportunity will allow you to showcase your expertise and make a significant impact. Reach out to me for more information.
I need a talented Blender artist to create a low-poly model of South Vietnam's Norodom Palace, including a simple interior. The primary purpose of this model is for animation. Ideal Experience and Skills: - Blender mastery and low-poly modelli...low-poly model of South Vietnam's Norodom Palace, including a simple interior. The primary purpose of this model is for animation. Ideal Experience and Skills: - Blender mastery and low-poly modelling skill. - Prior work in architectural modelling. - Understanding of basic interior design to fashion a simplistic representation of the palace's interior. - Ability to create animation-ready, efficient models. - Experience working with low-poly assets for animation. Deliverables: - Low-poly model of the Norodom Palace. - Simp...
In need of a skilled 3D video editor to transform my logo into a bold, horror-themed introductory sequence for my YouTube channel. Details: - This project entails the conversion of a JPG logo into a thrilling 3D logo integrated with a horror theme. - The logo should evoke mystery and drama through the incorporation of shadows and subtle movements. - While a modern design is preferred, the ultimate goal is a dramatic atmosphere that intrigues viewers. Ideal Skills: - Experience in 3D logo design and video editing. - Familiarity with creating horror-themed animations. - Projects involving YouTube intros will be advantageous. - A creative mindset and attention to detail. - Advanced skills in creating lifelike shadows and mysterious movements.
I am seeking a skilled freelancer experience in SketchUp to craft a 3D interior design model of key areas in my home. These areas include: - Living room - Kitchen - Bedroom The goal is to achieve a consistent modern aesthetic across all these spaces. Freelancer should demonstrate a strong grasp of modern interior design principles and extensive prior experience with SketchUp 3D modeling. Experience in architectural design and visual arts is a plus. Understanding of lighting and texture in 3D space, to effectively capture the look and feel of modern interiors is desired. The successful bid will deliver a design that blends function and style in a harmonious manner, adequately representing my vision for a modern, comfortable and visually appealing living space.
I am in need of a well-versed programmer to develop software that makes it possible to create an event based on a predefined budget. Users should be able to input their budget at the start and watch it decrease as they add services. The software should encompass the following services: - Venues - Catering - Decorations - Musicians - Vocalists - DJs, Models - Photographers - Videographers - Live Bands - Chefs - Hosts - Bartenders - Transportation - MCs As the software will be interactive and user-centric, the ideal candidate should have previous experience in UX/UI design and a solid understanding of financial management systems or budgeting functionalities. Because I need this project delivered ASAP, experience in quick turnaround projects or agile development methodologies will...
I need a freelancer proficient in Prompt Engineering , Python and Pinescript who can provide prompts to use with Large Language models ( gpt , gemini , claude ai ) . Where those prompts are used to convert pinescript indicators' logic to python. Requirements include: * Extensive knowledge in Pine Script . * Extensive knowledge in Prompt engineering with LLM. * Experience in converting TradingView Pinescript to Python.
I am looking to create a 3D animated video that brings children stories to life. The video should be engaging, colorful and tailored specifically for toddlers aged 1-3 years. The ideal freelancer for this project will have: - Expertise in 3D animation - Previous experience in creating animation for young children - Ability to create storylines that appeal to toddlers - A creative, imaginative approach to their work Key project details: - The 3D animation video should run for 3-5 minutes. - The style should be cartoon-based, perfect for catching toddlers' attention. - The content must be suitable and beneficial for the cognitive development of the targeted age group. Freelancers should bid based on the delivery of a single 3-5 minute video. However, there ...
...mastery in their responses. - Include their direct and equivalent experience in data analysis using SPSS software. - Linear models: Introduction to linear models Fitting linear models Multivariate linear models Assessing confounders and interactions Fitting and interpreting linear Models with several predictors. - Logistic regression: Interpreting logistic regression models. Model fit, selection and testing logistic regression assumption. Reporting logistic regression models Multinominal logistic regression - Survival Analysis: survival analysis ...
I require a skilled 3D artist to create a model and render of my electronics product for social media exposure. The render should portray not only the overall product but also emphasize its functional components. Ideal Skills and Experience: • Extensive 3D modeling and rendering • Detail-oriented • Experience with electronics products • Creative interpretation skills Objective: • The 3D model should be a fusion of realism and style, maintaining an accurate depiction of the product while injecting some artistic flair to make it more appealing to the social media audience. Your final deliverable should be a high-quality 3D model and render of the electronics product, with focus on the functional components, formatted suitably for social...
Good morning, The mission is to finalize the app 'Z-anatomy' () () and to set up a functional webviewer linked to a database from it. This project is open source and non-commercial; it aims to provide the first open source 3D atlas of gross anatomy online and to let me update it in the future autonomously (I'm a blender 3D modeller specialized in anatomy). Due to the non-commercial nature of the project, the budget is 500 euros; the details can be negociated. Responsibilities Fix language/definitions bug, Create a function to handle exceptions of children staying visible, Show the bonus collections in the first popup window, Add the possibility to modify size and side of the lateral windows, Create an URL-based