Access file data added vb net punët
Qysh je qa bone deshta me te pyt a din me mnimu ne ReactJS me bo 1 searchbox me hooks qe ka access ndatabase(firebase). vetem kjo funcionality po mvyn me shtu.
Qysh je qa bone deshta me te pyt a din me mnimu ne ReactJS me bo 1 searchbox me hooks qe ka access ndatabase(firebase). vetem kjo funcionality po mvyn me shtu.
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
Hello we are looking to make 2 simple changes to our shopify website order confirmation email. - We would like to add the product SKU in the email - We would like to make the product tile, image and sku clickable to it takes customer to the product page This is so when people need to reorder an item they can simply go to th...email - We would like to make the product tile, image and sku clickable to it takes customer to the product page This is so when people need to reorder an item they can simply go to their previous order confirmation email and click on the item or search it on the website by the SKU. We will send you the code and you will edit it and send back to us and we will paste it into shopify. No shopify access will be given. Looking to have this done immediately. $...
I'm lookin...compatible with all current Android versions. Key Requirements: - Develop front-end and back-end of the app - Implement in-app purchasing functionality - Ensure the app supports all current Android versions Data Management: - I prefer direct database access for content management - Utilizing third-party services for a more seamless and efficient data processing Ideal Skills: - Proven experience in Android app development - Proficiency in implementing in-app purchases - Strong understanding of both front-end and back-end development - Familiarity with managing data via direct database access and third-party services This project offers a great opportunity for a talented Android app developer to showcase their skills in creating a vers...
I'm looking for an experienced web scraper to access and download specific information and images from the Used Inventory section of the White Rock Honda website. Here are the specifics of what I need: - Car make and model - Year of the car - Price of the car For each car listing, I need ALL available images downloaded. Furthermore, I require the images in JPG format. Candidates applying should have successful experience in web scraping, data extraction, and handling myriad images. Efficiency and accuracy are critical for this project.
Hi We are launching an upcoming case battles website and require a designer. We are looking to design about 30 cases to start then 1-3 a month. We have a base case template designed added then we will provide a theme for each case. This project is for the first case then we will look to do the remaining 29. The budget is $10 per case The first case theme is for a creator called Riiski you can see his theme is green and also with a crocodile which we would like to use. so we want the case to be themed for Riiski and also a title given to the case called the Riiski Creator Case Riiski twitter : Ill attach the croc and the twitter header so you get an idea of theme. Remember we still want to see the CASE elements so it still looks like a case just apply
I'm in the process of applying for several entry-level positions in the tech industry, and I'm looking for an adept resume writer who can highlight my skills and relevant experiences. - You should have a profound understanding of the t... as well as what top tech companies look for in an entry-level candidate. - Your task will be to draft a resume that emphasizes my potential and readiness to contribute to a high-paced tech environment. - Previous experiences with writing resumes for entry-level positions in the tech industry are highly favorable. - Understanding of recruitment trends and applicant tracking systems would be an added benefit. Your expertise will significantly contribute to fitting my competencies into a concise, yet eye-catching resume that stands out i...
...Google Sheets expert to construct a live dashboard/leaderboard that visually represents daily sales tallies completed by individual sales reps. Key specifications: - Data to be pulled from a Master Google Sheet. - Incorporation of both total sales and individual rep sales. - The dashboard should display sales data for the current day while maintaining access to historical data. - Historical sales data should be visualized through a bar graph. Skills & Experience: - Attention to detail - Time management and delivery on tight deadlines - Proficiency in Google Sheets - Experience in creating dashboards. - Familiarity with data visualization and report generation - Strong analytical skills and precision Your ability to deliver this projec...
...particularly leveraging AWS WAF, AWS IP Reputation, and AWS CloudTrail. Key Responsibilities: - Implement rigorous access control policies to ensure only authorized personnel can access our resources. - Configure and fine-tune AWS WAF to establish robust web application firewall rules, block specified IP addresses, and provide protection against DDoS attacks. - Set up and monitor AWS IP Reputation, ensuring that any malicious IP addresses are effectively blocked from our system. Skills and Experience: - Proven experience in implementing AWS security measures, particularly with AWS WAF, AWS IP Reputation, and AWS CloudTrail. - Strong understanding of encryption protocols and access control policies within AWS. - Experience with monitoring and logging tools to ensu...
I need a skilled professional to help me creating email servers to send bulk emails and managing. - **Email Marketing**: I have been using the server for bulk mailing and email marketing. I need an expert who can optimize these operations, ensuring that the emails are being delivered effectively and not marked as spam. - **Troubleshooting and Support**: Although I did not select th...the future. It would be great if the individual could provide this assistance as needed. The ideal candidate for this project is someone with extensive experience in managing email servers, particularly with SMTP, bulk mailing, and email marketing. A deep understanding of email deliverability and anti-spam measures is crucial. Experience with troubleshooting and providing support would be an added ...
...GPS metadata. I need an expert to convert this metadata into Google Earth points. Key requirements: - **Automatic Generation:** The points should be created by extracting metadata from the images, not manually added. - **Output Format:** I need the final points to be saved in KML format, for easy integration into Google Earth. - **Quality Assurance:** Accuracy is key, the points should correctly represent the image positions. They will be broken into 3 colours depending on the date they were taken, the data is in the folder name and file name. Ideal Skills: - **GPS Data Handling:** Understanding of how to extract and work with GPS metadata from images. - **Google Earth Proficiency:** Experience in creating KML files and working with Google Earth is...
I need a professional with experience in Odoo to implement accounting reports in Odoo saas~16.3+e (Enterprise Edition). The reports should be exportable as XLSX or CSV files. Required R...Display existing inventory as of a specific date. Price and cost information. 3-Sales Tax Display total sales within a specified time period. Consider both taxed and untaxed sales. Additional Features: *Ability to specify dates for the report results. Example: For the "Inventory Summary FEB 2024" report, be able to search for results for January or other previous months. Access and Meeting: Upon project acceptance, access to our Odoo system will be provided. A video call will be required for a brief orientation on how to obtain the reports Examples of the reports are attached a...
I'm looking for a proficient professional who can create a report in Microsoft Access from a MySQL database. The report should contain data from the MySQL database, calculations or summaries of data, visualizations or charts, and be structured as a paginated report, using SQL language. The report should be designed to be accessed as a printable PDF document. It is not required to be interactive, as a static report is sufficient for my needs. Key Requirements: - Proficiency in Microsoft Access, MySQL, VBA, PDF, Python, and Excel - Competency in SQL language for data manipulation - Experience in designing paginated reports The ideal candidate should have a proven track record of creating similar reports, with the skills and knowledge necessary to w...
I need a professional graphic designer to convert my existing logo into a high-quality PNG file. This project requires: - Converting the logo into PNG format, suitable for various use-cases - Flexible approach in providing the logo in different dimensions as needed - Providing the logo in JPEG format as well Ideal skills: - Graphic design - Proficient in Adobe Illustrator or similar software - Experience in logo editing and file conversion
I've recently established a venture named "Atlas Truck Parts" and am in need of a unique,...are blue and white. Specific requirements include: - Use a combination logo format (includes text and symbol) - Make use of white and blue colors - Create a logo that embodies the essence of a truck parts company In terms of skills and experience, proficiency in graphic design and a portfolio featuring logo designs are essential. Experience in creating logos for a similar industry would be an added advantage. I would like to incorperate the ATLAS statue with the man holding the world on his shoulders, eith remove the globe and insert a truck or possibly the business name instead just as an idea or stretch out the initial "ATP" in block letters as the trailer and...
The ideal candidate will possess a comprehensive grasp of the intricate regulations surrounding the legal rights of individuals implicated in drug-related DUI charges, coupled with expertise in specimen handling and upholding the chain of custody's integrity. To support the development of two content pieces, an array of evaluations and a significant volume of personal data will be furnished, necessitating strict adherence to medical documentation protocols. It is crucial to independently assess the evidence provided to mitigate potential biases from prior MRO reports and offer an additional expert viewpoint. Content Pieces: 1. Simplifying toxicology for a lay audience and the media. 2. Incorporating new information beyond the court-mandated disclosure for anticipated outcomes....
...maximum and agencies should not apply. Key Responsibilities: Design and develop a user-friendly mobile application for iOS and Android platforms. Implement AI and NLP (Natural Language Processing) features for online interaction with users with future development for offline interactions. Integrate selective caching for offline access to critical conversation threads. Work with RESTful APIs for server-side features and NMEA (National Marine Electronics Association) data integration. Develop and manage a comprehensive database to handle user profiles, chat histories, and app analytics. Collaborate with UI/UX designers to ensure the app is intuitive and engaging. Ensure the application is compliant with all relevant maritime safety and communication standards. Optimize p...
...experience with Windows operating system and a proven track record with software troubleshooting, ideally custom company softwares. The ideal candidate would be proficient in understanding and rectifying software-related issues, ensuring minimal downtime, and facilitating smooth operations. Your quick understanding of our company software and capability to resolve issues effectively will be an added advantage....
...perform audio forensic tasks on a series of MOV format audios. These tasks are specifically centered on: - Identifying added or altered sounds, Each audio runs for less than 10 minutes. I am seeking a review of less than one minute of video and specifically a few seconds of the quoted audio "Fuck You" to use for comparative resources. I'm anticipating your professional input in: - Speech enhancement The ideal candidate would bring extensive experience in audio forensics, with an ability to reliably confirm audio authenticity for legal purposes. Experience in working with MOV file formats would be a major plus. At APPROXIMATELY 2:00 minutes in a series of "Push Push Push" begins and "Fuck You"
I need a skilled developer to create a website that will serve as a platform for managing and tracking services. The website will primarily target business clients, and as such, must be prof...and for providing transparency to our clients. Skills and Experience: - Proven experience in developing similar service management websites - Strong understanding of user experience and user interface design for business clients - Proficient in web security and data protection - Ability to create a streamlined and efficient system for managing service information. Need to be able to allow new customers to on board and be able to use a storage system that can constantly expand as users grow and pictures of services keep getting added Looking for something extremely close to
I'm looking for an experienced Woocommerce developer to enhance the functionality of my motorcycle parts website. Specifically, features to be added include: - A tailored search functionality allowing visitors to efficiently navigate the site using dropdown menus, and filters by Make, Model, Year and CC The final product should be an intuitive, user-friendly, fast, and modern eCommerce platform tailored towards motorcycle enthusiasts. The ideal collaborator has a strong track record in creating custom Woocommerce websites and a good understanding of user-centered design.
...current color palette needs to be updated to something more appropriate for a religious website. - Modify layout: The layout requires adjustments for better user experience and visual appeal. - Add custom features: I'm open to new features that can enhance the functionality of the site, such as an event calendar, donation functionality, or a prayer request form. - All SEO related features to be added. - Responsive Ideal Skills and Experience: - Proficiency in front-end web development - Prior experience in theme customization - Strong understanding of user experience design - Familiarity with religious websites' ethos and design trends - Ability to work within tight deadlines If you're confident in your ability to deliver high-quality work in a timely manner, I&...
...database is required for anything. Preferably, it should be accessible, responsive, and use SEO. Analytics are not wanted and the website should be GDPR compliant. The home page should contain a Services section, Location section, and About section. Any content (such as titles) or external variables (such as API keys and email addressees) should be modifiable easily from a markdown (.md) file or text (.txt) file, rather than directly in the code. The booking page should use a wizard to walk users through the booking process one step at a time. Users do not login, so always checkout as a guest. Firstly, users select a future date from a calendar. Secondly, users see the times each of the 7 lanes are available on the chosen date and select a lane at a given time for a give...
For the described functionality, I will bill a total of 48 hours, amounting to $960 USD. Initially, I will bill for 24 hours. Upon completion of the work, I will bill the remaining 24 hours. Date of completion:- 24...contextually appropriate prompts & responses. Module 2: Quick Search IPC, Scopes The functionality for identifying IPC codes and defining scopes must be quick, efficient, and precise. Module 3: Document In-depth Analysis This module offers detailed feedback on patent drafts and drawings, addressing all patentability criteria effectively. User History Access A robust system for tracking and retrieving past submissions and work history to facilitate easy access for users. This feature will ensure that users can review and continue their previous work withou...
I'm looking to hire an experienced web developer to create a website that caters to professionals. The main goal of this website is to provide information, so it will not require e-commerce capabilities. Key Features: - User Registration and Login: The website should have a user registration and login system to allow professionals to create their accounts and access specific content. - Search Functionality: A robust search functionality is crucial to help users easily find the information they are looking for. Target Audience: The target audience for this website is professionals. It is vital that the design and functionality of the website can cater to the needs and expectations of this demographic. Ideal Skills and Experience: - Proficient in web development and design, w...
...specific task. I need a formula that will COUNT cells based on the following criteria: - I need to COUNT the number of cells in a range that are greater than -250 - The count should be done for the last 50 cells (ongoing) Your task will be to help me create a formula that dynamically counts the number of cells based on the above criteria. I need this formula to be able to adjust as new values are added to the range. The ideal Freelancer for this project should have: - Extensive experience with Excel functions and formulas - Strong understanding of dynamic range referencing in Excel - Excellent communication skills to explain the logic behind the formula in layman's terms Please include any relevant experience in dynamic COUNT functions in your bid. I'm looking for ...
I need to create a console project in C# Net Framework that I can listen the data from an equipment Mindray BC-20s and / or BC-30s. Using Ethernet configuration and HL7. The data that comes from the clinical equipment needs to be save it on txt file. The configuration is using TCP/IP and I need - Port for every equipment Any questions? I made a console project but I could no be able to get the results from those equipments. I need a person who had been working with HL7.
I am seeking a developer to create an in-depth offline property abbreviation dictionary portal, accessible as a desktop or mobile application, allowing users to easily search and access property-related abbreviations and their full meanings without requiring an internet connection." Key requirements: ▪︎ The website should provide comprehensive word definitions ▪︎ Include abbreviations and provide their full definitions ▪︎ Both word definitions and abbreviations must be thoroughly explained Ideal Skills: ▪︎ Proficiency in website development ▪︎ Experience in creating educational resources or similar platforms ▪︎ Excellent command of the English language ▪︎ Attention to detail, ensuring accuracy and completeness of every word definition and abbreviation. Through this platf...
Confirmis () is a Singapore-based business information provider specializing in connecting businesses with global capabilities; comprised of industry veterans, Confirmis's business model is designed to overcome perennial lack of data (let alone quality data) to support effective decision-making, particularly in developing economies. As a Site Verifier, you will be responsible for verifying a company’s existence through visual data by conducting a site visit to ensure that we provide reliable and accurate information to our client. JOB DESCRIPTION: • Conduct basic verification with the subject company’s authorized representative, such as line of business, key executives' names, etc. • Take pictures of the subject company and its vicinity...
...allows clients to easily place orders, with fields for specific requirements and preferences. File Upload Capability: A secure portal for clients to upload digital impressions or design files, supporting multiple file formats. Payment Gateway Integration: A reliable and secure payment system that enables clients to pay for their orders online, with support for major credit cards and digital wallets. Responsive Design: A mobile-friendly website layout that adjusts seamlessly across various devices and screen sizes. SEO and Content Strategy: Implementation of SEO best practices to improve search engine rankings, along with engaging content that positions us as industry experts. Customer Support: Easy access to customer support, including live chat, phone, and email co...
I'm looking for freelancers to help me secure backlinks from guest posts. If you have access to website DA 60+ in Ahrefs, you can quote your price per guest post. Look, I already have contributors working on it, so, don't just quote in a silly manner, reasonable prices will be accepted. Criteria: -60+ DA in Ahrefs -Must be indexed by Google, only pay for indexed posts. Thank you.
Título del proyecto: Aplicación de registro digital de parte de anestesia Descripción: Se requiere una aplicación móvil multiplataforma desarrollada en .NET MAUI que permita el registro digital de un parte de anestesia. La aplicación debe ser capaz de conectarse a una cámara a través de Bluetooth o Wi-Fi para tomar fotos cada cierto intervalo de tiempo (por defecto, cada 3 minutos) y utilizar OCR o IA para interpretar y obtener los signos vitales del paciente (frecuencia cardíaca, saturación de oxígeno, tensión arterial, etc.) a partir de las fotos tomadas. La aplicación deberá generar un gráfico de línea de tiempo donde se representen los signos vitales en el eje Y y la...
I'm looking for a skilled photo editor to smooth out the background of my dance studio shoot photos. The background has a few wrinkles that need to be removed without losing any detail. Key Requirements: - The wrinkles should be edited out in a manner that preserves the intricate de...original background. - The focus should be primarily on the background and not on the subjects in the photo. Ideal Skills and Experience: - Proficiency in photo editing software, such as Adobe Photoshop or Lightroom. - A keen eye for detail and a good understanding of background editing techniques. - Prior experience in working with studio shoot photos, particularly in the dance industry, would be an added advantage. Please provide samples of your past work, particularly in background editing,...
...Your expertise in Social Sciences is of essence and shall be fundamental in this project. - I require assistance in extracting relevant studies from top-tier UK or USA journals. Familiarity and access to vast academic journals are absolutely necessary. - I'm focused on qualitative research and expect appropriate methodologies to be applied in this study. -I require that the writer must not use AI generated text or sources. AI sometimes CREATES references that do not exist! Only true writers may apply please. Skills required: - Extensive experience in Social Sciences. - Should have privileged access to premium academic journals in UK and USA - Familiarity with qualitative research methodologies. - An ability to synthesize complex concepts and give an in-depth unders...
...member registration, subscription tracking, member services management, and trade references. The system should facilitate data import from Excel and accommodate online and offline accessibility based on the user’s capacity to meet online hosting costs. Member Registration: Develop a module for member registration capturing key details such as Name, address, and any other contact information. Village, group, area, district, province, sub-group affiliation (e.g., Study circle, VSLA, commodity association etc.) Demographic information (age, gender, household size, etc.) Implement functionality to adapt and import member data from Excel sheets. Enable different access levels (Project team, Donors and trading partners) for viewing, analysis and with rights edit...
Creating...proficiency will let you deliver a platform that not only meets our audience's needs but also reflects our commitment to quality service. Experience in building dynamic, interactive web pages is extremely valuable for this project. We will start with one project and see how quickly it can be done, for what cost, and what quality. You must be able to navigate our existing domain and ensure we can access and modify our pages later on, and duplicate where needed. A note: our old webpage still exists - but the pages attached to it no longer work or aren't applicable, many were compromised by malware, and the person who built it all out is gone and nowhere to be found. That said, the brand theme is there and is a good guide to get an idea of what we're doi...
I'm in need of a skilled CAD designer to create a simple STL file for prototyping purposes. Key Requirements: - The design should consist of basic geometrical shapes. - It is intended primarily for prototyping use, so the emphasis is on simplicity and functionality. The ideal freelancer for this project should have: - Proficiency in CAD design, particularly in creating 3D printable files (STL). - Experience in creating simple, functional designs for prototyping purposes. - Strong communication skills to ensure the final design meets the intended purpose. Please note that no specific dimensions are required, as the proportions are flexible. The main goal is to create a suitable file for the prototyping process.
I'm in need of a skilled CAD designer to create a simple STL file for prototyping purposes. Key Requirements: - The design should consist of basic geometrical shapes. - It is intended primarily for prototyping use, so the emphasis is on simplicity and functionality. The ideal freelancer for this project should have: - Proficiency in CAD design, particularly in creating 3D printable files (STL). - Experience in creating simple, functional designs for prototyping purposes. - Strong communication skills to ensure the final design meets the intended purpose. Please note that no specific dimensions are required, as the proportions are flexible. The main goal is to create a suitable file for the prototyping process.
I'm seeking a talented...- related proteins within Protein-Protein Interaction networks. Key Requirements: - No Data Availability: You will be responsible for sourcing a suitable dataset for this project. The dataset should be substantial, relevant to healthcare, and appropriate for predictive analysis. - Designing, Implementing and Evaluating a Strategy. - Evaluation of the Model - Making predictions on a New Test Set Ideal Candidate: - Strong Machine Learning Skills: You should have a proven track record in creating predictive analysis models. - Healthcare Industry Knowledge: Little experience in working with healthcare datasets would be a significant advantage. - Data Sourcing Ability: Being able to identify and access appropriate datasets is crucial for...
I currently have a website set up. Users are able to register/login and are redirected to a My account page. On this My Account Page I need users to be able to upload Pics/videos add a short description and submit. Once submitted I need the posts to go to a user specific "My Documents" page that only the user and admin can access.
I'm in need of a skillful designer to create a basic online portal, web or app, where my small hotel's rooms can be monitored and rented out. Key requirements: - Designing the platform to be responsive, enabling users to access and interact with it from various devices. - Tenant will only request for booking and Booking should confirm only by landlord. After confirmation tenant should be able to book. -Calendar Integration: A feature that enables tracking of room occupancy to prevent double booking. - Implementing an inventory management system that will enable me to monitor the availability of items in rooms at the hotel. - Including a functionality to monitor any defects that might occur in the rooms. - Inventory Maintenance: A system to monitor room conditions, track ...
I am working with GridCore library from .NET Core. I am having issues getting the column headers to be displayed with the filters added. Now, I am only able to display the column headers titles. I need someone that has proven experience using this library and can give me the solution.
...assistance in drafting a demand letter for an insurance company, with an aim to claim reimbursement for property loss. The property involved is my vehicle, the damages of which have been accurately captured in photographs. Ideal applicants will have a background in law, specifically with experience in drafting demand letters for insurance claims. Knowledge about automobile insurance claims would be an added advantage. Key tasks: - Understanding the case based on the photographs provided - Drafting a persuasive demand letter outlining the damage and cost of the vehicle - Creating a letter that complies with legal standards Preferred skills and experience: - Legal expertise, specifically in insurance claim - Excellent written communication skills - Experience in drafting demand...
I have a file uploading system installed in my localhost server that's working perfectly. But when I tried to move it to an IIS server, it's not working.
I'm seeking a skilled Laravel developer to resolve a stubborn issue we are encountering on our video subscription website. Subscribed users are currently unable to access any videos on the site, and we need this fixed urgently. Key tasks: - Identification and resolution of the subscription issue preventing user access to all videos - Ensuring that only subscribed users have uninterrupted, total access to our video content. Ideal experience and skills: - Extensive background in working with Laravel - Proficient at troubleshooting and resolving subscription and accessibility issues - Prior work with video streaming platforms would be a strong advantage. Your main duty will be to restore functionality swiftly, ensuring our subscribed users' seamless intera...
I am embarking on the creation of an engaging, user-friendly website for my charters company. The site will be an instrumental part of my business operations, allowing clients to book transfer services from Hobby Airport to the cruise terminal. Key Features: - **Booking System**: The primary function of the website will be to facilitate bookings for our transfer services. Clients...ideal candidate, I would prefer someone with: - Proven experience in developing booking websites, especially within the travel or transportation sector. - Strong skills in e-commerce and payment gateway integration. - Past experience in creating websites with live chat support. - Capability to deliver a visually appealing and mobile-responsive design. - Knowledge of SEO best practices would be an added ...
