Access metadata vb net punët

Filtër

Kërkimet e mia të fundit
Filtro sipas:
Buxheti
deri në
deri në
deri në
Lloji
Aftёsitё
Gjuhët
    Shteti i punës
    2,000 access metadata vb net punët e gjetura, me çmimin EUR
    Project for Diellza R. Ka përfunduar left

    Qysh je qa bone deshta me te pyt a din me mnimu ne ReactJS me bo 1 searchbox me hooks qe ka access ndatabase(firebase). vetem kjo funcionality po mvyn me shtu.

    €19 (Avg Bid)
    €19 Oferta mesatare
    1 ofertat
    Project for Ardit H. Ka përfunduar left

    Qysh je qa bone deshta me te pyt a din me mnimu ne ReactJS me bo 1 searchbox me hooks qe ka access ndatabase(firebase). vetem kjo funcionality po mvyn me shtu.

    €19 (Avg Bid)
    €19 Oferta mesatare
    1 ofertat
    Programing Ka përfunduar left

    Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc

    €11380 (Avg Bid)
    €11380 Oferta mesatare
    4 ofertat
    Crie um Website Ka përfunduar left

    Desenvolvedor .NET MVC, SQL e ADVPL Protheus

    €2764 (Avg Bid)
    €2764 Oferta mesatare
    1 ofertat
    qefqreqweqawdafsc Ka përfunduar left

    asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr

    €186 (Avg Bid)
    €186 Oferta mesatare
    1 ofertat
    yveguwvcjnjnecbkhb Ka përfunduar left

    ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif

    €106 (Avg Bid)
    €106 Oferta mesatare
    1 ofertat

    User Authentication: User Interface: - Implement role-based access control to ensure that users only have access to features relevant to their roles within the company assigned by administrators and can view dashboards, Statistics and data access based on role privileges. Adaptive Employee Management: - Provide flexibility in employee profile fields, allowing administrators to customize add/remove fields such as contact information, job history based on the company's specific needs and Enable employees to update personal information like contact details or emergency contacts. - Store and organize employee documents, contracts, policies in database and Display for compliance purposes. Flexible Leave Management: - Allow administrators to configure various leave ...

    €220 (Avg Bid)
    €220 Oferta mesatare
    13 ofertat

    I'm urgently looking for a highly skilled frontend developer for the creation of a professional dashboard. The dashboard must support both right-to-left and left-to-right languages and encompass a variety of features: • Data visualization: this is crucial for us to visually comprehend our information and data. • User management: we need this to streamline profile access, security, duties, etc. • Report generation: this feature should enable us to create comprehensive reports. • Graphs It is must be hight quality

    €129 (Avg Bid)
    €129 Oferta mesatare
    24 ofertat

    I'm in need of a skilled Swift developer with experience in implementing in-app purchases in macOS applications. The application is already built and functioning, but I require assistance in adding a subscription-based in-app purchase feature. Key Requirements: - Have access to the Apple Developer Program and experience in submitting in-app purchase features to the Apple Store - Proficient in Swift, as the application is built using this language - Ability to implement subscription-based in-app purchases seamlessly - Experience in the development of macOS applications and complying with Apple Store guidelines Your responsibilities will include: - Implementing the subscription-based in-app purchase into the existing macOS application - Ensuring the in-app purchase feature is f...

    €10 (Avg Bid)
    €10 Oferta mesatare
    1 ofertat
    Experienced C# Developer Needed 6 ditë left
    VERIFIKUAR

    I'm seeking a proficient C# developer, skilled in the .NET framework for a project. The exact application type is still to be confirmed. You should have: - Strong experience with C# programming. - Understanding of .NET framework. - Ability to work without strict time constraints. Time frames and further project details will be discussed upon connection. Looking forward to working with a focused and motivated professional.

    €135 (Avg Bid)
    €135 Oferta mesatare
    34 ofertat

    ...Services Procurement Specialist to identify and engage with vendors and disability service companies that offer or require American Sign Language translation services. This role involves researching British Columbia and Federal Government procurement lists, as well as other relevant platforms, to gather contact information and assess potential partners for our consulting services. Responsibilities: Access and navigate various government procurement databases to locate vendors offering ASL translation and related accessibility services. Identify disability service companies across Canada that align with our service offerings. Compile detailed contact information and create a strategic rationale for outreach to each identified vendor or company. Maintain a structured database of ...

    €39 (Avg Bid)
    €39 Oferta mesatare
    9 ofertat

    I'm urgently seeking a reliable and creative React Native Developer to build a unique app for my business. Despite the information gaps, the app should ideally have: - User Authentication: Ensure users can identify themselves before gaining access. - Push Notifications: A tool to engage users. - In-app Purchases: Improve revenue stream. The ideal developer for this project should be proficient in the use of React Native and experienced in incorporating these functionalities. It's a bonus if you have a knack for creating user-friendly designs that encourage interaction and drive profits. Please include: - Examples of your past work, specifically involving React Native. - A detailed proposal defining your approach to this project. - Your overall experience as a React Nati...

    €115 (Avg Bid)
    €115 Oferta mesatare
    13 ofertat

    I have a set of printed documents that need to be transcribed into an Excel sheet for easy access and analysis. The data is primarily textual, composed of various types of written information. Requirements: - Expertise in data entry, particularly with Excel. - Proficient in English to accurately interpret the text. - Experience with printed document transcription is preferred, but not required. The ideal candidate must be detail-oriented and meticulous, as the accuracy of the data entry is crucial.

    €6 / hr (Avg Bid)
    €6 / hr Oferta mesatare
    31 ofertat

    ...would use. There are lots of Shopify repositories here: along with lots of code on the web. Ideally much of the functionality would come from already existing code, but GPT can also be used to rapidly develop code. Here's a breakdown of the APIs, webhooks etc. needed for the functionality we'd like: 1. Order Tracking Shopify Admin API: Use this API to access and manage order data, providing real-time tracking updates to customers. Webhooks: Implement webhooks to receive real-time notifications on order status changes. 2. Shopping Cart Management Shopify AJAX API: Use this API for a seamless shopping cart experience that allows customers to add items to the cart, update quantities, and view cart contents without reloading the page. Storefront

    €14 / hr (Avg Bid)
    €14 / hr Oferta mesatare
    1 ofertat

    ...Integrations:** - **Messaging Platforms:** WhatsApp, Facebook Messenger, email, and SMS. Additionally, PBX system integration is required to bridge our voice call capabilities with digital communication channels. - **Features:** Essential features we're looking for include: - **File Sharing:** Ability to share documents, images, and videos across all channels. - **Chat History:** Seamless access to previous conversations for context and continuity in customer support. - **Chatbot Integration:** Capability to integrate AI chatbots for automated responses and assistance. **Ideal Skills and Experience:** - Experience with API integration for WhatsApp, Facebook Messenger, email, SMS, and PBX systems. - Proficient in developing chat platforms with functionalities ...

    €2036 (Avg Bid)
    €2036 Oferta mesatare
    52 ofertat

    I was utilizing a server running Alamlinux9.3 with Virtualizor for my virtualization needs. However, after a recent reboot, the server failed to start up properly. Despite troubleshooting attempts, the system remains inaccessible. The datacenter has provided access to the server via sysrcd (SystemRescueCd), but I lack the expertise to efficiently recover the system and get it operational again. I am seeking assistance from experienced system administrators or IT professionals who have expertise in Alamlinux, Virtualizor, and system recovery. The goal is to diagnose the issue, recover the system, and ensure it is functioning correctly. Tasks: Diagnose the cause of the server failure after reboot. Implement necessary steps to recover the Alamlinux9.3 system. Ensure that Virtualizo...

    €309 (Avg Bid)
    Urgjent
    €309 Oferta mesatare
    5 ofertat

    Kami mencari programmer .NET dengan spesialisasi Blazor NET 8 dan diutamakan yang sudah familiar dengan Kendo UI dari Telerik. Di bayar berdasarkan satu project dengan term pembayaran sbb: Pembayaran 1: 20 persen (progress project 25%) Pembayaran 2: 25 persen (progress project 50%) Pembayaran 3: 20 persen (progress project 75%) Pembayaran 4: 25 persen (progress project 100%) Pembayaran Akhir: 10 persen (setelah UAT customer)

    €1145 (Avg Bid)
    €1145 Oferta mesatare
    8 ofertat

    Install Wordpress and PHPlist on my server and provide instructions on how to access from my PC.

    €27 (Avg Bid)
    €27 Oferta mesatare
    5 ofertat

    I need an experienced data scientist or AI specialist to assist with evaluating a Ko...data evaluation using OpenAI API calls. - Proven track record in achieving optimal inference speeds for data processing. - Demonstrated ability to balance and optimize processing accuracy alongside inference speed. - Strong communication skills to provide regular updates on the project's progress. refer to this documentation; request for access to the example document where all the testing data and instructions should be maintained and updated; API example;

    €138 (Avg Bid)
    €138 Oferta mesatare
    8 ofertat

    Confirmis (www.confir...key executives' name, etc. • Take pictures of the subject company and its vicinity, as per Confirmis’ standard operating guidelines. • Provide observation about the company to gauge activeness, e.g., staff working at the premise, loading/unloading of goods, etc. REQUIREMENTS: • Must be living in (or nearby) Kepanjen, Malang • Has a camera or phone/tablet of quality with a camera, internet access Please see the attached file for the site visit guideline. You are only required to deliver the pictures, video & observations and are not expected to put together a report like the Sample Report. Note: Milestone will be released the following week after the site visit to give us time to organize the report and contact you i...

    €9 - €14
    Lokale
    €9 - €14
    0 ofertat

    Description: I'm seeking an experienced AWS and Django developer to urgently fix a "502 Bad Gateway" error that started occurring on my Django-based website hosted on an AWS EC2 instance after an IAM role change. The task will also involve reviewing and revoking AWS access previously granted to a developer, and ensuring the site's security and integrity. Responsibilities: Diagnose and resolve the "502 Bad Gateway" error. Review and modify IAM permissions to ensure both security and functionality. Confirm that all components of the AWS environment (like EC2, RDS) are properly configured and interacting without issues. Ensure the Django application is securely configured and fully operational. Provide a brief report on the changes made and any recommend...

    €151 (Avg Bid)
    €151 Oferta mesatare
    28 ofertat

    Confirmis (www.con...name, etc. • Take pictures of the subject company and its vicinity, as per Confirmis’ standard operating guidelines. • Provide observation about the company to gauge activeness, e.g., staff working at the premise, loading/unloading of goods, etc. REQUIREMENTS: • Must be living in (or nearby) San Fabian, Pangasinan, Philippines • Has a camera or phone/tablet of quality with a camera, internet access Please see the attached file for the site visit guideline. You are only required to deliver the pictures, video & observations and are not expected to put together a report like the Sample Report. Note: Milestone will be released the following week after the site visit to give us time to organize the report and contact you if we ...

    €9 - €12
    Lokale
    €9 - €12
    0 ofertat
    Retail Store Visualizations 6 ditë left
    VERIFIKUAR

    I'm looking for a skilled professional with experience in creating visual ...store layout designs. For this project, you will build on the data model you created in Project 1. You will be analyzing and creating visualizations of the data contained in your Access databases. All instructions for the project can be found in the PDF attached. Ideally, the successful freelancer should have: - A strong portfolio showcasing past retail design projects - Proficiency in retail space planning and product display - A deep understanding of customer flow optimization - Excellent communication skills to understand my vision and bring it to life - Ability to deliver the final visualizations in MS Access format Please provide examples of your past work and how your experience aligns ...

    €32 (Avg Bid)
    €32 Oferta mesatare
    17 ofertat

    ...contractor to handle projects and technical support. The task involves installation of network equipment (switches, access points, and security cameras for both indoor and outdoor areas). Your role will involve: - Mount/Install network equipment as directed - Field technical support - Remote support Contractor should carry liability insurance and C7 license is preferred Ideal candidates should have extensive experience with network cabling and a track record of executing similar projects successfully. It's crucial for the freelancer to be proficient in handling varieties of network cables especially Cat 5e, Cat 6 and Fiber optic cables, and familiar with network switches, access points, speakers, and security camera installations both indoor and outdoor....

    €9406 (Avg Bid)
    Lokale
    €9406 Oferta mesatare
    2 ofertat

    ...expert Access Developer to undertake some key aspects of a large-scale relational database for our office team. Tasks include: - Database Design and Development: Plan and construct a robust relational database incorporating more than 20 tables. - Form Creation and Customization: Create and customize user-friendly forms for data input and manipulation. - Report Generation and Analysis: Design analytical reports that will aid our decision making. Ideal skills: Proficiency in Microsoft Access, understanding of relational database theory and form design, experience with report generation and analysis. Prior experience working on large-scale databases would be a plus. This project offers a challenge but also a great opportunity for you to showcase your expertise and abili...

    €669 (Avg Bid)
    €669 Oferta mesatare
    35 ofertat

    I need an age verification popup for my website that is displayed upon entry to any page. Key requirements: - Ability to change validation type (e.g. Over/Under 18; Date-of-birth, Year-of-birth) - see images - Ability to change images, text, background and redirection address (for Under 18) - To remember age verification forever (for Over 18s) and this session for Under 18...requirements: - Ability to change validation type (e.g. Over/Under 18; Date-of-birth, Year-of-birth) - see images - Ability to change images, text, background and redirection address (for Under 18) - To remember age verification forever (for Over 18s) and this session for Under 18s I already have a mock up design and imagery files available. The website is hosted by Neto e-Commerce and I have full access to ...

    €81 (Avg Bid)
    €81 Oferta mesatare
    80 ofertat

    I'm seeking a proficient individual for constructing an Access database for my project. The principal requirements include: - Experience with Access, as that's the selected database management system. - Expertise in data storage and retrieval is essential. - The database will be storing textual and numerical data. Experience in handling these types of data is crucial. Ideal skills would include an in-depth understanding of Access, database design, data storage/retrieval techniques and knowledge in handling both textual and numerical data. This should make for a streamlined and efficient process. I'm excited for us to kickstart this project together!

    €30 (Avg Bid)
    €30 Oferta mesatare
    5 ofertat

    ...Users should be able to make purchases directly through the interface - Access Control: Secure access to certain information or features based on user roles - Loyalty Program Management: Implement a loyalty program to incentivize user engagement - User Portfolio: Users should be able to customize their interface with links, contact information, and product displays - **iOS App Development:** I need an iOS app to complement the NFC interface and provide a seamless user experience across different platforms. Ideal candidates for this project should have: - Proficiency in developing both NFC card interfaces and iOS applications - Experience with payment processing integration - Strong background in access control and user management systems - Familiarit...

    €92 (Avg Bid)
    €92 Oferta mesatare
    6 ofertat

    ...conducting employee performance reviews. This will be a crucial tool primarily utilized by team managers. Key Features: - The website should facilitate the process of conducting performance reviews. It should allow managers to set goals, document uploading and feedback, and track progress of administrators over time. - The platform should include a user-friendly interface for managers to easily access and navigate through. - Integration with email services is essential. Notifications for upcoming reviews, reminders, and other relevant communication should be sent through this system. - Calendar scheduling tools should also be incorporated to allow easy organization of review meetings. Ideal Skills and Experience: - Proficiency in web development, particularly for building inte...

    €788 (Avg Bid)
    MRS
    €788 Oferta mesatare
    57 ofertat

    As an organization, we aim to significantly boost our network security. Thus, we're seeking a skilled professional capable of: - Configuring firewall - Implementing an effective Intrusion Detection System - Establishing secure remote access Unfortunately, we skipped out on specifying our preferred secured remote access service and the size of our network infrastructure during the initial stages. However, we encourage applicants to be fully versatile with VPN, SSH, RDP, and to be equipped to handle infrastructure of various sizes. Prior experience with these areas will be advantageous. Do you have what it takes to help us execute a thorough network security overhaul? If so, we want to hear from you!

    €437 (Avg Bid)
    €437 Oferta mesatare
    11 ofertat

    I am facing an issue on my Windows system where the internet disconnects every time I connect to my OpenVPN. This issue is significantly impacting my ability to work remotely and access the resources I need. Key Points: - The issue started occurring when I began using OpenVPN. - I work on my system and the VPN is a critical part of my workflow. - The problem is specific to my Windows operating system. I am looking for a professional who has: - Profound experience with troubleshooting VPN connection issues, especially with OpenVPN. - Strong knowledge of Windows operating system networking and its interaction with VPNs. - Excellent communication skills and can guide me through the troubleshooting process in a clear and understandable way.

    €31 (Avg Bid)
    €31 Oferta mesatare
    9 ofertat

    We are using an online field service software platform called Uptick for our field technicians to carry out inspections of fire systems. The online software we use generates a PDF report based on the field technician inputs. We have access to the CSS/HTML/DJango source code to modify the PDF output. We require a developer who will work with us to generate a PDF output based on our design by modifying the existing source code. Please note: The developer must be willing to discuss the project via [Removed by Freelancer.com Admin for offsiting - please see Section 13 of our Terms and Conditions] so that clear instructions can be discussed as to the required PDF output.

    €87 (Avg Bid)
    €87 Oferta mesatare
    38 ofertat

    ** Please do not apply. If you don’t meet the must have criteria at the beginning of this job description post. We are looking for a motivated and successful grant writer located within Canada! The grant writer will be responsible for locating, researching, and applying for potential funding opportunities in order to ...Comprehensive knowledge of research, and the ability to distinguish and identify Ontario/Canadian Grant opportunities • Ability to work effectively under pressure; • Excellent writing and verbal skills; • Be highly organized with the ability to implement systems and follow-up processes; • Proficiency in research, interpreting, and analyzing diverse data; • Excellent Computer skills (Microsoft Office Word, Access, PowerPoint and Excel),...

    €734 (Avg Bid)
    €734 Oferta mesatare
    24 ofertat
    Visual Paradigm & MS 6 ditë left
    VERIFIKUAR

    Project Title: "Customer Order Management System" for an online retail business in MS Access. Objective: To develop a comprehensive database system that allows for efficient tracking and management of customer orders, inventory, and shipping. Key Features: 1. Customer Management - Store customer information including name, address, email, and phone number. - Track customer order history. - Customer feedback and preferences. 2. Inventory Management - Maintain a detailed list of products, including product ID, name, description, quantity in stock, and reorder levels. - Automated alerts for low stock levels. 3. Order Management - Enable creation of new orders with customer information, order details (product, quantity, price), and shipping method. - Trac...

    €40 (Avg Bid)
    €40 Oferta mesatare
    3 ofertat

    I'm in need of someone adept at PHP and SOAP. My development site is currently returning a warning message: "Attempt to read property "Invoice_Number" on string." I've set up a dev SOAP server for you to carry out the work. At this point, I'm uncertain if I'm attempting to access the "Invoice_Number" property on a string. There are also no other error messages accompanying this issue. Key tasks: - Identify the cause of the "Invoice_Number" warning - Fix the PHP SOAP warning Ideal skills: - Proficiency in PHP - Experience dealing with SOAP - Ability to troubleshoot and resolve such issues promptly

    €138 (Avg Bid)
    €138 Oferta mesatare
    31 ofertat

    ...that is easy to navigate. - It should support live streaming capabilities in high quality. - A Video-on-demand library should be integrated to provide a variety of content for viewers. The panel should come with the following functionalities for user management: - User subscriptions management: allowing the administration of user accounts and subscriptions. - Multi-user access control: enabling different levels of access for various users. - User activity tracking: to monitor and analyze user engagement with the platform. Ideal candidates for this project should have experience in: - Developing Android applications, particularly in the field of IPTV. - Building user-friendly interfaces and ensuring smooth user experiences. - Implementing live streaming capabilities and m...

    €139 (Avg Bid)
    €139 Oferta mesatare
    20 ofertat

    We are seeking an experienced software developer to join our team and work on developing a secure and scalable VPN/Internet gateway solution. This project involves building server software capable of authenticating client connections and providing access to the internet. Requirements: Master's degree or PhD in Computer Science, Cybersecurity, or a related field Extensive experience in internet security, privacy, and VPN technologies Strong proficiency in server-side software development Familiarity with OpenWrt and router firmware development (preferred) Passion for internet security and privacy Responsibilities: Develop robust Wireguard exit nodes and VPN server software Ensure seamless integration with existing client software and VPN router firmware Implement secure authe...

    €37 / hr (Avg Bid)
    €37 / hr Oferta mesatare
    17 ofertat

    I want to set up an online shop on my website and have it connected to Fresha CRM, the system I currently use. This shop should have a so...Experience: - Proficiency in e-commerce development and CRM integration - Strong portfolio of elegant and sophisticated web design projects - Previous experience with integrating payment gateways - Excellent understanding of user experience and online shopping best practices is wordpress Need also to edit the website to look better! Need to create a shop where the client when access our website to buy directly from website and not from fresha which we are using now! About crm I m looking to integrate voucher / membership and most important when the client do an appointment from our website need to integrate with fresha if possible

    €425 (Avg Bid)
    €425 Oferta mesatare
    110 ofertat

    ...will pay commission per placement. This person can also bring in any other consultants on our payroll (Separate incentives for this) We don't need anyone who works on Job boards. Need someone with strong relationship in the market Job Types: Part-time, Freelance Ideal Skills and Experience: - Proven experience in IT Bench Sales recruitment is a must. - Strong network in the IT industry and access to potential candidates. - Proficiency in utilizing various sourcing techniques and tools to identify and engage with potential candidates. - Excellent communication and negotiation skills to ensure the successful onboarding of Senior-level candidates. - Experience in the freelancer recruitment model is a plus. This will be a freelance position and I'm open to discussing ...

    €280 (Avg Bid)
    €280 Oferta mesatare
    1 ofertat

    I am looking for an expert in RFID technology and .NET programming to integrate the RFID into our current weighbridge system. Key Details: - 3rd Party System was developed using .NET and it does support API or external interface connections. - The task will involve programming to fully integrate the system with RFID technology. Skills and Experience: - Proficiency in .NET programming & SQL Database - Previous experience with RFID technology - Knowledge of API integration - Experience with weighbridge systems would be a huge advantage. Your role will be to ensure the smooth functioning of the weighbridge system post-integration and provide us with a user-friendly, effective RFID solution.

    €844 - €1688
    €844 - €1688
    0 ofertat

    I am seeking a skilled developer fluent in Solidity to develop a web3 smart contract using the Base Sepolia Test Net. Your task will involve: - Developing web3 integration - Designing the simplest UI possible Ideal candidates should have previous experience with Ethereum blockchain technology, Solidity programming distinct to the Base Sepolia Test Net, and the creation of adaptable user interfaces. A background in web3 integration is highly desired. Please provide samples of smart contracts you've developed or relevant project references in your bid.

    €225 (Avg Bid)
    €225 Oferta mesatare
    26 ofertat

    I need a small metal shade structure built for a few horses to provide both sun and rain protection. The design should be durable, weather-resistant, and easy for the horses to access. - Materials: As indicated, the shade structure must be primarily built with metal for longevity. - Size: 40'X13' Ideal skills for this job include: - Experience with metalwork and construction - Understanding of, and experience with designing structures for animals, particularly horses - Knowledge of local weather conditions to best determine structure design. - drawing must meet Maricopa County standards

    €911 (Avg Bid)
    €911 Oferta mesatare
    45 ofertat

    ...and alert me about any potential security breaches. - Log Gathering: I'll need the app to effectively and securely gather logs from IoT devices. - Access Control Management: It should have the ability to manage and control access to the security system. Logging Mechanism: - The application should be able to log activities from sensors and smart home devices effectively. Ideal skills and experience: - Strong Python programming skills, coupled with experience in security applications. - Proficiency in designing and implementing robust intrusion detection systems. - Prior work on IoT device integration and data gathering. - Experience in access control management is a plus. - Understanding of secure logging mechanisms. In your bid, please include examples of ...

    €304 (Avg Bid)
    €304 Oferta mesatare
    5 ofertat

    ...Melbourne CBD to a storage facility in Ringwood. The job is pretty straightforward, no need for additional packing materials, just transporting the boxes and putting them into the storage unit. Key Requirements: - Move 15 cartons, each measuring 50x40x50cm, from Melbourne CBD to Ringwood - Put all the boxes into the storage unit Additional Information: - No stairs involved, the apartment has elevator access - No requirement for packing or unpacking assistance, just need someone to follow the instructions and lay all the boxes in the storage Ideal Skills and Experience: - Experience in removalist or moving services - Reliable and careful in handling delicate items - Familiarity with Melbourne CBD and Ringwood area Please provide your quote for the job and indicate your availab...

    €18 - €152
    Lokale
    €18 - €152
    0 ofertat

    I am seeking researchers in Manchester, UK to conduct market research for a retail audit. The ideal candidate should have good communication skills and access to a smartphone. You must be available immediately. You will visit 30 bars in the city of Manchester, UK and the payment for this project is €390. For this project, the product costs and materials that will be needed to assess the product will be reimbursed. Specific requirements for the project include: - Conducting a retail audit in Manchester, UK - Collecting data and inputting it into an app Skills and experience needed for this project: - Strong analytical skills - Excellent communication skills - Ability to finish the project by a specific deadline - Flexible schedule Please get in contact if you are interested ...

    €691 (Avg Bid)
    Lokale
    €691 Oferta mesatare
    2 ofertat

    Confirmis (www.con...name, etc. • Take pictures of the subject company and its vicinity, as per Confirmis’ standard operating guidelines. • Provide observation about the company to gauge activeness, e.g., staff working at the premise, loading/unloading of goods, etc. REQUIREMENTS: • Must be living in (or nearby) San Fabian, Pangasinan, Philippines • Has a camera or phone/tablet of quality with a camera, internet access Please see the attached file for the site visit guideline. You are only required to deliver the pictures, video & observations and are not expected to put together a report like the Sample Report. Note: Milestone will be released the following week after the site visit to give us time to organize the report and contact you if we ...

    €9 - €12
    Lokale
    €9 - €12
    0 ofertat

    I'm in need of a skilled developer to build an exam portal web application. Key Features: - User Registration and Login: Implement a secure system to allow students to register, log in and access the platform. - Exam Creation and Management: Develop tools for examiners to create and manage exams. This should include the ability to set time limits, number of questions, and other relevant parameters. - Result Generation: Implement a function that will accurately calculate and display exam results to students. Additional Information: - The portal will only be supporting specific types of exams. - The ideal candidate should have experience with similar projects and be able to provide a secure, user-friendly and efficient solution. - The project requires an understanding of good ...

    €657 (Avg Bid)
    €657 Oferta mesatare
    29 ofertat

    I have a VBS script which downloads files from a server to the a folder on my local machine or onto AWS (MS Win Server 2012 R2). This script can be manually activated (double click) or via Task Scheduler. Recently the script stopped working. I think it has to do with AWS permission/read/write errors. I need to have this investigate and fixed. The person needs to understand AWS EC2 and VBS and JS scripting.

    €134 (Avg Bid)
    €134 Oferta mesatare
    12 ofertat

    I have previously worked code in and stored but it stopped working because readyPromise doesn't work and in that case, it can't load sequently and crashes. New Java stuff?? I...sequently and crashes. New Java stuff?? It doesn't recognize readyPromise with var/const only works as await. Async has problems too. Even without Crashing tilesets seem not to load both from ION and Private/Public Domain. Need to solve this ASAP. You need to download files and work within your Domain or IDE or any other way to work directly with CESIUM LIBRARY!!!!! Or I will give you my Domain FTP access to the project folder and you can Upload .js .html files and see RESULTS in this directory as it will load html and js: YOU HAVE TO WORK WITH CESIUM LIBRARY!!

    €18 (Avg Bid)
    €18 Oferta mesatare
    15 ofertat

    I'm looking for an artist to paint roses on my China coffee pot in the Edelstein Delphine style. The purpose of this project is purely decorative. Key Requirements: - The style of painting should mat...to copy the colors and shapes of the roses on the bowl for the coffee pot. Ideal Skills and Experience: - Experienced artist with a good eye for detail and the ability to replicate a specific style. - Previous experience in painting on China or delicate surfaces would be a plus. - Good communication skills will be essential to ensure the final product matches my expectations. If you don't have access to enamel paint that can be baked on, I have some for you to mix and use. If you're confident you can recreate the Edelstein Delphine style of roses on my coffee pot, I...

    €76 (Avg Bid)
    €76 Oferta mesatare
    74 ofertat