Access report vb net converter download punët
Qysh je qa bone deshta me te pyt a din me mnimu ne ReactJS me bo 1 searchbox me hooks qe ka access ndatabase(firebase). vetem kjo funcionality po mvyn me shtu.
Qysh je qa bone deshta me te pyt a din me mnimu ne ReactJS me bo 1 searchbox me hooks qe ka access ndatabase(firebase). vetem kjo funcionality po mvyn me shtu.
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
Project information: * Purpose of project: This project aims to gather high-...specific phrases to say, particular tones or emotions to express, or a certain speed at which to speak. * Technical Skills: Basic knowledge of how to use recording equipment or software is necessary. They should be able to handle the technical aspects of recording, such as setting the correct volume levels and ensuring there's minimal background noise. * Reliable Equipment: They need to have access to a good quality microphone and a quiet environment to ensure the audio recordings are clear and free from background noise. * Time Commitment: They should be able to commit the necessary time to complete the required recordings. * Good understanding of English as instruction will...
I'm seeking a highly skilled and experienced Java developer with proficient knowledge in MYSQL and IntelliJ for the creation of a user-friendly Boarding Management System. This project involves a two-page application with an intuitive and aesthetically pleasing GUI. Key Features Requirements: - Employee Management: This system should have an administration level and employee level access. Details to be tracked for each employee include Name, Contact Information, their Attendance record, and data pertaining to Exits and Returns such as Exit Date, Exit Time, Return Date, and Return Time. The ideal freelancer for this project should be one who pays attention to detail, meticulously records data, and ensures concise coding practices. A keen understanding of user interface and u...
I'm looking to commission a mobi...This project requires experience with both iOS and Android platforms. The primary features of the app should include: - Paid Membership System: Only users with paid membership can use the app. Therefore, a secure payment handling system should be implemented. - Member Check-in/Out: Develop tools to ensure easy and efficient check-in/out system for members. - Visitor Access: The app should cater to visitors and provide easy access management, likely requiring a guest login or similar mechanism. The ideal candidate for this job will possess a strong background in developing fitness-based mobile apps with similar features. They must know how to handle payment systems securely, and experience with developing membership check-in/out system...
I'm seeking a skilled freelancer to install and configure the aMember platform on a WordPress site. You'll be focusing on several functionalities and key features, and these include: - Enabling the user registration and login function. - Managing subscriptions. - Controlling content access based on subscriptions. The ideal freelancer for this job should be proficient in WordPress and possess a deep understanding of the aMember platform. It would be beneficial to have experience in setting up and configuring these features on similar projects. Further, the payment gateway to integrate with the aMember platform is PayPal. The successful bidder should have a thorough understanding of how to integrate PayPal into aMember to ensure a smooth and seamless transaction process f...
The goal of this project is to verify a ...computing problem using the SMV system and to modify the solution so that it satisfies basic safety and liveness properties. Key Duties: - Analyzing system behavior - Identifying design flaws - Verifying system properties Ideal Skills: - In-depth knowledge of software model checking - Proficiency in SMV (Symbolic Model Verifier) tool Software/Hardware Requirements: - SMV model checking tool - Access to high-performance computing power could be beneficial - Be prepared to work with specific software libraries if the need arises How To Win This Bid: - Exhibit your experience and competence in SMV model checking - Highlight any experiences in identifying design flaws and testing system properties - Show past work relevant to SMV mode...
I'm experiencing an issue with the integration of Stripe on my web application. The technical problem at hand is that the application is charging the user's credit cards, however, those users are not being granted access to their respective accounts. Whether there's any specific user account management system in use or the technology stack on which the application was constructed, I'm currently uncertain. The freelancer I'm seeking ideally has: - Solid experience with Stripe API and handling common integration issues - Ability to identify, debug, and resolve problems in a system with unspecified user account management - Proficiency in working with various technology stacks given the lack of information on the exact one being used on the web app. The main ...
...crud operations. A file server where users can upload download and delete files. Once user login successfully they should be able to see 2 tabs on a web page, one for employee data, they should be able to perform the CRUD operations. Another tab for file server where user can downloaduploaddelete a file. Tech Stack - HTML/CSS/JavaScript for frontend. - Angular or React for frontend framework - SQL as DB - JWT for handling user authentication and authorization - A file server running locally on windows machine User Scenario 1. User should be able to access the home page and able to register themselves and should be able to login based on credential validation 2. Upon successful login, user should be able to manage employee and access file server (files),...
...Management * Resource Planning * Client Management Specific functionalities should include: * Dashboard: to monitor and control all activities efficiently * Staffing: to manage resources effectively * Projects: to manage different ongoing projects * Timesheets: to track work hours and performance * Holidays: to manage leaves and availability * Invoices: to manage billing and payments * Multiple Report Generation: for diverse insights and forecasting * Payroll: to handle employee compensation Experience with SaaS development and a comprehensive knowledge of ERP systems for design firms will be highly appreciated. Your creativity and innovation will be a key element in building a user-friendly and efficient interface as well as a smooth backend. Partner with us to build this all...
...development, including API integration and user interface design. Knowledge of data security and privacy laws. Familiarity with the fashion and retail industry is a plus. Deliverables: A fully functional virtual try-on software application that can be integrated with an online retail website. Documentation detailing the software architecture, AI models used, integration guide, and user manual. A detailed report on the AI model's accuracy and user feedback analysis. Project Timeline: The project is expected to be completed within 4-6 months from the start date, with periodic milestones for initial prototypes, user testing, and final deployment. Application Process: Interested developers should submit a proposal that includes: An overview of their experience with similar pr...
As an owner of a Windows-based ERP system developed in VB.NET, I need the expertise of an adept software developer. Key tasks include: - Bug Fixing: Issues causing system crashes and incorrect data calculations need to be isolated and fixed. - Enhancements and Feature Development: The...reporting capacities. Expertise in integrating third-party software is a plus, as well as experience in designing streamlined workflow automation. - Performance Optimization: An overhaul to increase system performance is a must. Ideal freelancers will have robust experience in VB.NET, ERP systems, software debugging, and have a keen eye for enhancing and developing new features. Deep knowledge in report augmentation, third-party software integration and workflow automation design is highly adv...
...Planning * Client Management Specific functionalities should include: * Dashboard: to monitor and control all activities efficiently * Staffing: to manage resources effectively * Projects: to manage different ongoing projects * Timesheets: to track work hours and performance * Holidays: to manage leaves and availability * Invoices: to manage billing and payments * Multiple Report Generation: for diverse insights and forecasting * Payroll: to handle employee compensation Experience with SaaS development and a comprehensive knowledge of ERP systems for design firms will be highly appreciated. Your creativity and innovation will be a key element in building a user-friendly and efficient interface as well as a smooth backend. Partner with us to build ...
I am in need of a professional who can create a bootable image using the most suitable version of Fedora. The image should incorporate a hypervisor and effectively initiate a Windows 10 virtual machine on a laptop with 4GB of RAM. In addition to this, I require the incorporation of a virtual switch and bridge so that any VM present can access the Internet through the wireless card or Ethernet port. The choice of the hypervisor should be guided by industry standards and the latest technologies. While I have listed KVM, VMware, and VirtualBox, I am open to alternatives as well should they prove to be a stronger match for my needs. Skills and Experience Required: • Creating bootable images • Working with Fedora and Windows 10 operating systems • Understanding of hype...
Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.
I'm currently in need of assistance to pass my Quickbook Proadvisor exam. I'm yet to begin studying the content and I also do not have access to any learning materials. Therefore, I am seeking a tutor who is an expert in this field and can provide effective in-depth tutoring and supply high-quality study materials. Key Responsibilities: • Provide one-on-one tutoring on all Quickbook Proadvisor exam content. • Develop a well-structured study plan that will improve my chances of passing the exam. • Provide necessary learning materials and resources. Ideal candidate: • A certified Quickbook Proadvisor. • Teaching or Tutoring experience is a must. • Excellent communication and patience.
I'm in need of an accomplished full stack developer to integrate my Node APIs with an Angular frontend. Key Project Deliverables: - User authentication: You'll be implementing a robust system for verifying user identities. - Data retrieval and display: You'll also need to link backend functionality with the frontend so users can access and interact with data. - Real-time updates: The application should show users any changes or updates as they happen. Given that we anticipate a small user base (1-100 users) at present, the preliminary focus is on function delivery over scalability. For the startup level of this application, basic security measures are required specifically focusing on data validation. Experience in Node.js, Angular, User Authentication, and Re...
For this bespoke venture, I'm searching for a talented programmer who is proficient in either Python or C++. batch understanding is a must! The primary task involves: - Developing a new API key login syste...this bespoke venture, I'm searching for a talented programmer who is proficient in either Python or C++. batch understanding is a must! The primary task involves: - Developing a new API key login system with a focus on implementing access control and permissions. This calls for deep understanding of SQL and batch. Ideal skills/experience include:- Hands-on experience in SQL, batch, and either Python or C++ for backend programming. - Demonstrated skills in developing and maintaining API key login systems. - Proven knowledge in creating permission-based access...
I need an expert video recorder to capture gameplay videos from mobile games, with a requirement of 2 to 3 videos per week. The gameplay videos will be shared across various social media platforms - specifically Instagram, YouTube, and TikTok. You will gain access to the social media accounts and you will need to post them with description and accurate hashtags. Skills needed: - Understand and experience in recording gameplay videos, mobile games. - Familiarity with Instagram, YouTube, and TikTok's video interfaces. - Timely delivery of video content – 2 to 3 videos per week. -Posting on Social Media Platforms with description and hashtags -Video Editing We need a constant collaboration. You would need to capture compelling gameplay moments, ensuring high-quality video...
Tasked with producing an informative and creative educational report of 120 pages, I am seeking the input of a qualified professional. This project will involve: - The thorough research and compilation of 12 scientific topics - Adherence to the Chicago style guide while creating the report - Use of a maximum of 3 resources for referencing per topic Ideally, freelancers bidding on this project should have a strong background in educational research, especially within the sciences. Expert knowledge of and experience with the Chicago style guide is a must. In-depth understanding of scientific subject matter and exceptional writing skills are paramount. The end product should be compelling, informative, and well-structured. I look forward to receiving bids from equally passiona...
We are looking for an experienced C#/.NET developer to fix issues for the existing Inventory management app. The app was integrated with the MySQL database. Requirements - C#/.NET Framework - desktop application development - MySQL database
I'd like to work with an AWS guru who can show me how to build a simple serverless ...with an AWS guru who can show me how to build a simple serverless webapp via AWS. This webapp would accept a stock symbol, and an optional additional prompt. It would then utilize Claude 3 Sonnet via AWS Bedrock to pull a recent news article and write a detailed investment analysis about the company. Additional work to follow incorporating a proprietary stock rating system that I would have API access to. I'm always looking for talent, so many more projects to come for the right person. Looking for someone who would be patient working with someone like me with an IT background. Someone with good English could show me the steps along to the way so that I could support this app and ot...
I already did your site seo audit. After accepting this offer I will deliver the report.
Seeki...separately. Proposals should specify the Azure region, services, and any relevant configuration settings. Operational maintenance and software development are not in scope for this work package. Deliverables: Architecture diagram of the proposed Azure infrastructure - prefer visio Azure cost estimation calculator output Deployment scripts and/or templates to provision the infrastructure - I have access to the azure portal only Documentation of the infrastructure setup, including any manual configuration steps Normal caveats: I prefer individual freelancers over companies, do please give me a useful proposal - your boilerplate proposals of "I have 7 year experience" or "I will work long hours to get this done" don't work. I need to be able to se...
I'm in need of a skilled front-end Bootstrap developer to work on various projects for next 1 year work time : 8am to 6pm Indian Standard Time price; INR 100 per hour you should track time using freelancer.com desktop app (download it if you don't have) you should have expertise in bootstrap and jquery&ajax PLEASE DON'T BID AND ASK TO INCREASE PRICE. ALL TERMS ARE NON-NEGOTIABLE you should start working right away. you should not ask about project details, you can ignore tasks which you couldn't do, and continue with other tasks
...Ideal Skills: - Extensive experience using Power Automate - Solid grasp of SAP and Financial Data - Advanced Excel skills - Previous involvement in invoice management systems - Strong knowledge of data extraction and reconciliation mechanisms Scope of Work: SAP Automation: Utilize Microsoft Power Automate Desktop RPA to automate tasks within SAP ERP, including data filtering, extraction, and report generation. Integrate Power Automate with SAP using no-code solutions for seamless data transfer. Financial Data Reconciliation: - Automate data retrieval from external financial systems like SBI e-VFS, Pine Labs, and CC Avenue. - Develop processes to reconcile data between SAP and these external systems, ensuring accuracy and consistency. - Implement logic for data m...
I ...need of a freelancer with a strong background in recruitment, particularly within the finance industry. Your task will be to recruit senior-level candidates with a solid foundation in Financial Analysis, Risk Management, Investment Management, as well as Record to Report. Key Skills and Experience: • Proven experience in senior-level recruitment • Deep understanding of the finance industry • Ability to identify potential candidates with expertise in Financial Analysis, Risk Management, Investment Management and Record to Report Your contribution will be instrumental in helping to find the right candidates who can drive our financial strategies and initiatives. If you have a proven track record in finance recruitment, your expertise is needed. Looking ...
...world of real estate. Here's the deal: - I need someone dedicated to property sales. Particularly, you’ll be handling residential properties. Ensure you have a strong understanding of the housing market and sales strategies. - This is a commission-based role centered in Hyderabad. An aggressive go-getter will find a lot of success in this position. - To help you hit the ground running, you’ll have access to our existing database. Use these connections to immediately begin finding matches for potential buyers. The ideal candidate will have a background in residential real estate sales and exceptional negotiation skills. An extensive network in Hyderabad’s property market is advantageous. Remember, your success in this role is directly tied to your ability ...
I am seeking a skilled PHP developer proficient in upgrading and modifying my existing SMS PHP script. Key components to this upgrade include: - Language Conversion: Currently, the script is compatibl...Conversion: Currently, the script is compatible with earlier versions of PHP. Your task would be to upgrade it to PHP 7/8. An understanding of the differences between these versions is essential. - Multi-User Functionality: I envision a system where different users can interact with the script simultaneously. This requires the introduction of individual user dashboards, role-based access control, and simultaneous user access mechanisms, accommodating less than 10 users initially. The source code of the current script will be provided. Prior experience with similar proje...
I am looking for a skilled Flutter developer to create a mobile application for both iOS and Android for my existing .net web project. The application will have the following features: - NFC and QR code scanning functionality for gathering information. - Ability to create points of interest that can be viewed on maps. - Real-time location tracking. Ideal Skills: - Proficiency in Flutter Development, .Net, and familiarity with NFC and QR technology. - Prior experience in creating map-based applications. - Knowledge of Turkish language, as the app will only support Turkish at this stage. Please provide examples of your previous work related to these technologies while bidding on this project.
I'm seeking an experienced trainer to provide a thorough understanding of SAP BW. We intend to enhance our capabilities in reporting and analysis, data integration, and transformation processes, with an emphasis on optimizing data modeling and performance tuning. The curriculum should cover: - Data Modeling - Data Extraction and Transformation - Report Creation and Analysis Ideally, the trainer should have an in-depth knowledge of these areas and a knack for imparting such knowledge effectively. This training is for a small group of 1-5 participants, so personalized attention and detail-oriented teaching would be beneficial. Traning must be in English and trainer should provide SAP BW System to log in and practice.
Czech Recording Project 6Male and 6Female need for this project. We have a project, that needs Native Czech speakers, we will give you the text, and you need to record 50 short sentences. you just need to download our software, to read our text and record it, it's a very easy job. 1. You will need to record in a quiet place without loud background noise. and without echo. 2. Each person is 5 dollars for 50 short sentences record. 3. The project will take about 10 mins only. If you are interested please let me know sure.I will contact u. A Good Opportunity For New Freelancers For taking 5 Star Review after their completion of the project. Thanks :
As a potential collaborator, I am seeking a proficient Flutter developer who can readily turn my XML files into a functioning Android app. The key tasks outlined for this job are as follows: * Implement API authentication for user access control and security * Enable the application to retrieve and store data through these API endpoints While I have provided all the necessary API documentation and endpoints, expertise in API integration and a deep understanding of Flutter is desired. Despite working with detailed specifications, creativity and problem-solving skills will make a world of difference. Don't hesitate to bid if you're up to the challenge.
For this design comp, I'm seeking a graphic design professional who can develop an innovative logo for advertising and marketing purposes. It needs to be text-based, cleverly communicating about my product/service. This is not a company logo or brand, it is a product that is offered by my company. The product is "Weekly Brief" and is a weekly report generated on property activity for my clients. Domain is -- and you're welcome to, but not required to include the domain details. You are also free to creatively play with adding "your", "the" or "local" to Weekly Brief if you want to. You have full creating control. This project requires creativity, a keen eye for detail and aesthetics, and an understanding of marketing strategie...
...target our specific audience within the education industry. - Constructing compelling ads that prompt potential customers to fill out a contact form or make a call to us. Ideal Applicants: - Proven experience in using Google Ads for sales increase. - Understanding of trends and behaviours within the education industry. - Proficiency in creative ad creation and optimisation. - Ability to track and report on results effectively. Our ultimate goal is to increase sales, so we need someone who can translate these actions into tangible results. Your ability to engage the audience, draw them to contact us, and subsequently convert these leads into sales will be vital. Note: This position is for serious applicants only with previous experience in similar roles - preferably within th...
...residential building. - System will eventually be used to handle a mini split ac (likely less than 20amp), outdoor outlet and potentially an indoor gfci outlet… but for now just the box is required with future capacity. - System will be mounted to the outside of a garage, with the new cable routed through the wall of the garage itself. It is hollow finished drywall that can be removed for this job and access to the studs behind. Owner will handle drywall. - Main breaker is less than 5 feet from desired spot for sub breaker and will require new fuse connecting the sub panel (there are plenty of spare spaces). - Expect system to have weather sealed hole in stucco for line from the main breaker and future circuit back inside. - Ensure the new system complies with the latest s...
I am in need of an experienced civil engineering designer or engineer to take on a comprehensive grading and drainage project for residential and commercial properties in Southern California. Key Responsibilities: * Civil grading and drainage design, * Erosion control plans * WQMP/LID report preparation * Earthwork quantities calculations * Cross-sections preparation * Hydrology report preparation * Pipes sizing calculations * Storm water design Ideal candidate would have: * Significant experience in residential civil engineering projects, * Strong knowledge and understanding of California building codes and storm water requirements. * Excellent knowledge of AutoCad Civil 3D. * Ability to manage civil engineering projects. * A testament to facing challenges head-on and c...
I am in dire need of a proficient C# developer with profound experience in API integration and token fetching. The central task involves revamping our existing project from an older API integration to a newer one. Key Tasks: - Seamless transition from older API to an advanced and more sophisticated one - Efficient fetching of access tokens Skills & Experience: - Specialist in API integration - Mastery in token fetching - High competency in C# Please note, I am not looking for a resume but a detailed project proposal that explicates your approach towards fulfilling the requirements of the project. API Functionalities: The older API is currently handling: 1. User Authentication 2. Data Fetching I am looking forward to a defined, purposeful structure in the newer API for...
I'm seeking a qualified and experienced FIORI Developer to implement a new logic quickly in a simple report Ui5, JavaScript, HTML5, CSS
...for parking stations along these lanes. Uploading Data to MyMaps: If bike lanes data is available in CSV or KML format, download it and upload directly to MyMaps to accurately represent them in your plan. Justification Paragraph: Write a paragraph explaining the rationale behind the choices for the operating area, parking zones, slow zones, and no-ride zones. This should highlight why these decisions are suitable for a tourist town like Cranbrook and how they benefit both the users and the town. Completion Timeframe: Have this proposal ready by tomorrow morning. Here are additional steps to help guide you through the process: Visit the Cranbrook Open Data site and download the bike lanes data. Open MyMaps and create a new map for Cranbrook, BC. Import the bike lanes da...
...discussed over calls with screen sharing and we'd talk through problems, figuring out the best approach to each ticket. Strong familiarity with git and branching is required. Our source code is hosted on GitLab and our app runs in a containerized environment, although experience with containerization (docker) is not required. All issues are posted to an internal issue tracker which you'll be given access to. This is an ongoing project where time tracking is a requirement. We are behind schedule in addressing some of the issues that will be described so fast turnaround times will be appreciated. I will be reaching out to applicants to have a call to explain the project and requirements. This will be done to determine that we will have a productive working relationship....
I need help with taking a combination of 3 distinct ID's and mapping them to financial data in another spreadsheet, without creating a new column at all. I need help distinguishing which combinations have financial data and which ones do not. I also need to share my screen so that someone can accurately help me.
...caters to member users. This website will hold a special focus on providing access to premium content reserved only for members. Key Features Required: - Inclusion of a member-specific login system in addition to the general user login functionality. - The member users, after logging in, should be able to effortlessly access the website's premium content. Premium Content: - The website will deal with services; these are the premium content that should only be accessible to member users. Ideal Skills & Experience: - Proven experience in creating user-specific login systems on websites. - Strong background in coding and website development. - Excellent understanding of designing and implementing premium content access systems. - A keen eye for user experi...
I'm looking for market insights about commercial real estate for office tenants within Maryland. Specifically, I'm interested in healthcare and medical businesses. Here's what I need: - Develop o.../ - This location has dedicated parking spaces for patients - Close Proximity to hospitals or other medical facilities The ideal freelancer for this job has experience marketing for rental of commercial real estate market, specifically dealing with office spaces. An understanding of the requirements of healthcare and medical businesses would be a significant advantage. Excellent research and report-writing skills are also a must. Please send previous work or state plan to get tenants to rent at the specific location (see the link above for the available office space). ...
...showcase their skills and experience. ========================================================== 1. User Management System Objective: To manage user accounts, profiles, and roles. Components: User Registration/Login: Different modes for customers, gas stations, and companies. Profile Management: Ability for users to update their personal and payment information. Role-based Access: Different access levels for individual users, gas station admins, and company fleet managers. 2. Gas Station & Discount Management System Objective: To manage gas station listings and discounts offered. Components: Gas Station Registration: Interface for gas stations to sign up and list their services. Discount Management: Functionality for gas stations to set up an...
...tournament fees collection and manage refunds where necessary. 5. Security and Compliance • Data Security: Implement and maintain security measures to protect user data. • Legal: Ensure the platform complies with relevant laws and regulations. 6. Feedback and Support • User Feedback: Collect and respond to user feedback for improving the platform. • Support System: Provide a system for users to report issues or seek help. Both Sides • Real-Time Communication: Implement WebSockets for live match updates and messaging. • Performance and Scaling: Use cloud hosting and a CDN for efficient content delivery and scalability. • Analytics: Integrate tools to monitor user engagement, tournament popularity, etc. With ability for admin to add Ga...