Access tally database vb net punët
Qysh je qa bone deshta me te pyt a din me mnimu ne ReactJS me bo 1 searchbox me hooks qe ka access ndatabase(firebase). vetem kjo funcionality po mvyn me shtu.
Qysh je qa bone deshta me te pyt a din me mnimu ne ReactJS me bo 1 searchbox me hooks qe ka access ndatabase(firebase). vetem kjo funcionality po mvyn me shtu.
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
...The work itself will be flexible, and we will respect your boundaries, but we will ask you to be available for help on many days of the year including public holidays or weekends. As you progress in this role, we may ask you to travel with our directors from time to time, all expenses will be covered by us. We will help your growth by having you join our public speaking courses and giving you access to all of our training courses, and we will ask you to invest in yourself by reading at least 16 non-fiction books per year with us. This will allow you to grow with our directors and keep rising to new heights. We are not looking for someone who just does what is asked. As a successful applicant, you will be proactive by becoming accelerators to the performance of our two most sen...
Confirmis (www.con...name, etc. • Take pictures of the subject company and its vicinity, as per Confirmis’ standard operating guidelines. • Provide observation about the company to gauge activeness, e.g., staff working at the premise, loading/unloading of goods, etc. REQUIREMENTS: • Must be living in (or nearby) San Fabian, Pangasinan, Philippines • Has a camera or phone/tablet of quality with a camera, internet access Please see the attached file for the site visit guideline. You are only required to deliver the pictures, video & observations and are not expected to put together a report like the Sample Report. Note: Milestone will be released the following week after the site visit to give us time to organize the report and contact you if we ...
We are in search of a specialist with expertise in developing mobile apps for both iOS and Android platforms. Our company specializes in automated trading software, and we require a mobile application for our customers to access their profiles and trading results. Key information: -web-based version already exist -we need to mirror web version in mobile APP -in-app notifications would by new essential addition -Graphical files and branding assets are already available. -both android and iOS Thank you for considering our request.
I'm seeking an experienced app developer capable of creating an information sharing application for both iOS and Android systems. The primary aim of the app surrounds the exchange and access of information. A key requirement is the incorporation of specific features such as: - User reviews: App users should be able to leave and view reviews. - Product search: To facilitate easy information access, the app should house a well-optimized product search feature. An ideal candidate should have extensive experience in both iOS and Android app development, with a focus on creating user-friendly interfaces and robust search functions. A familiarity with integrating user review systems would be beneficial. These combined skills will contribute dramatically towards creating a...
...well structured - reproducible steps for others - spell & grammar checked coding requirements: - clean code in terms of clean code book - best practices for development (code level documentation, common patterns, OOP as possible) - best practices for agreed and choosen libs/frameworks - classes are reusable for later extensions and reuse options (after MS4) Deliveries? - in our on premise git (access will be granted to you) - full sources (NO! Jupyter Notebook) - multiple samples of videos will be shared via URL to download - bash to build & run your code - poetry build - latest stable python version - libs, need prior confirm and we prefer to use mostly latest stable versions - your code is working on our end too - your code passes our CI build (with provided maven ca...
• Ability to define detailed acceptancecriteria • Experience in Requirement gathering for the user access effectively • Collaborate with all stake-holders to ensure all acceptance criteria have been met during the post- releaseprocess • Project planning and associated tasks: Maintain Project plan, Managed Facilitate meetings • Ability to deliver working solutions on a tight schedule • Conducting stakeholder meetings with the project stakeholders as and when required • Work with the Quality Assurance team to ensure complete coverage of listed out acceptance criteria • Ensure issues are identified, tracked, reported on and resolved in atimely manner • Attend sprint planning meetings and work towards defining the sprint items along with the ...
I'm urgently seeking a proficient Android app developer to create a one-of-a-kind dialer app. I need a custom dialer app. My requirements are: Access to device's contacts, browse and search through contacts list within the app, Automatic disablement of default phone dialer or any other dialer apps upon installation,Unique call duration calculation starting at 50 seconds, incrementing by second for each second of the call, and Visible display of call duration during an ongoing call Ideal skills for this job: • Solid background in Android app development • Experience in creating dialer apps or similar • App design proficiency • Excellent time management skills • Strong problem-solving capabilities • Ability to work to tight deadlines • St...
The site was created on WordPress * Set up link personalization so that by clicking on a link sent from the site, the page o...admin panel * Create in the admin panel the ability to enable/disable automatic sending of invoices * Change the error text when entering incorrect login information on the site * Configure sending an email to the user after granting access to the site * Add a function for automatic publication of advertisements with a check for the presence of contact information in the advertisement. There should be an option to enable/disable this function in the admin panel. * Set a password on the accounts page in the admin panel and on the server on the database (folder) where the accounts are saved, so that no one except one admin (me) can view, delete or...
...in. This is an e-commerce website that sells construction tools, building materials, as well as bath and kitchen items. The site must include: - A product listing feature that has comprehensive details on each item. - Shopping cart functionality that allows users to add and manage items they wish to purchase. - User registration and login mechanisms to enable easy sign-up and returning customer access. - A product search feature for quick item locating. - Product filtering to allow users to narrow down their search based on specific criteria. - A payment gateway integration for seamless and secure online transactions. Ideal freelancers for this job should have: - Proficiency in WordPress, with experience in creating e-commerce sites. - Strong understanding of UX/UI design to en...
...the site. Set up and troubleshoot an SMS notification system using the Twilio API. Create a feature for sending contact verifications via SMS, with automatic data storage in both admin panel and user dashboard upon login and verification. Enhance site security to protect user data and prevent unauthorized access. Embed video content from Vimeo in a way that conceals the source from users. Display text lessons clearly and ensure all content is accessible. Add a system for users to request access to all lessons, which sends notifications to an admin for approval. Implement a tracking system in the admin panel to monitor user progress, including current lessons, quiz attempts, and overall performance. Design a new, user-friendly admin dashboard for easier management and overv...
I'm in need of a skilled developer who can create a VB.NET application for access control in our security system. Key Requirements: - Integrate the application with ZKTeco ElitePass, Proface X, and Speedface devices - Implement user access control functionality, focusing on efficient and secure access management Access Denial for Blacklisted Users: - The app should automatically lock doors to deny access to users on the blacklist Ideal Skills and Experience: - Proficient in VB.NET - Experience with integrating devices in a security system - Strong understanding of access control systems, especially with regards to user management and real-time decision making
...the developer but he has disappeared. About a month ago I received an email from TNT ... quote There is a change coming to the TNT RTT API, this is what you use to get pricing for shipping on your online store or internal system. Please have this email directed to whomever controls the online portal: You are currently using the ASP version of the RTT service, and we need customers to move to our .NET version. This will require that the XML payload is URL encrypted, note there is no change to the content of the XML just how it is presented. I have included the newer spec doc but it should be a simple process. endquote I am at a loss on how to update or replace this extension. The links in the email take me to a blank page. The attachment is confusing, but you might be able to mak...
...content management system on my site. This site will not only serve as a platform for community building, but will also facilitate the sharing of user-generated content and private messaging between users. Key responsibilities: - Implement e-commerce functionality to enable users to purchase products or services. - Develop user registration and login system to allow users to create accounts and access personalized content. - Integrate a content management system to enable easy editing and updating of site content. The successful candidate should have: - Proven experience in full-stack web development with a focus on e-commerce, user registration, and content management system. - Strong understanding of user experience design principles. - Previous experience in building online ...
...aesthetically appealing.. This is an opportunity to work on stunning pieces that will be adorn by people of all background types and establishments. We are excited to find a dedicated professional that can bring these luxury designs to life. To review sample designs and renderings to give you a better understanding of the types of luxury furniture we deal in, please review the link below for access.
I'm searching for a proficient .NET developer to design and build an MRZ scanning plugin for Windows utilizing the device camera. The plugin must be able to handle the following documents: - Passports - ID Cards - Emirates ID Card (National ID of United Arab Emirates) No specific MRZ scanning library is currently preferred, so I welcome any suggestions. Ideal skills and experience for the job: - Proficiency in .NET language - Experience working with MRZ scanning plugins - Familiarity with different types of ID documents - Ability to integrate this plugin into Windows systems successfully - Experience with device camera utilization - Strong understanding of MRZ data extraction I am anticipating a product that efficiently captures the MRZ data from the aforementioned ...
I need a skilled Full Stack React Native Developer to create an app for both iOS and Android. This app will accompany a wearable device, and aims to offer the following features: - **Notifications**: The app should be able to receive and display notifications from the wearable device. - **Sign up/Log in**: Users should be able to create accounts and log in to access the full functionality of the app. - **Reset**: The app should be able to facilitate resetting the wearable device as necessary. - **Find My Device**: A feature that will help users locate their wearable device if it goes missing. - **Profile**: Users should be able to set up and manage their profiles from within the app. - **Allied Features**: Any additional features that we have for the user experience. Ideal candida...
I'm experiencing a "Forbidden: You don't have permission to access this resource" error on my entire WordPress website. It happened after I made some updates to the site, and now it's completely inaccessible. Ideal candidate for this job would: - Be an experienced WordPress specialist - Have previous case studies of successfully handling similar issues - Be skilled in troubleshooting and rectifying website errors Key Tasks: - Investigate and diagnose the problem causing the forbidden error - Implement a solution to rectify this problem and restore full access to the website - Verify the solution to ensure the error doesn't recur. Your responsibilities would include making sure the error is permanently fixed and ensuring the website runs...
I need a Terraform configuration to provisi...EC2 instance with Security group, Keypair, VPC components, CloudWatch logs and WAF integration. The EC2 will be launched in Private Subnet, with ALB and no direct traffic allowed to the instance. A Bastion/jump server for SSH to EC2. EC2 connects to the internet using NAT-gateway. WAF to be integrated with ALB, and ALB only listens on HTTPS. Security groups are restricted with limited access. Allocate and associate an elastic IP to the instance. The EC2 instance will run Ubuntu and serve as application server. I can provide AMI image of the web-app. It is a Python FastAPI/Nginx app. No other service is needed like RDS or S3 etc. Docker or Kubernetes are not needed, and the app is not using any Databases. It is a Single Region Deployment...
...partner vendors listed in the BC and Federal Government's procurement directories. The role involves pinpointing vendors that provide accessibility services, such as video captioning and sign language interpretation, which are complementary to our consulting offerings. The specialist will evaluate these vendors to determine potential collaboration or contracting opportunities. Responsibilities: Access British Columbia and Federal Government procurement databases to extract a list of vendors offering specific accessibility services. Assess each vendor's service offerings to determine compatibility with our consulting goals, particularly in enhancing Deaf accessibility. Compile a comprehensive list of potential partner vendors, including detailed contact information a...
...online hub where trading card enthusiasts can engage in a vibrant marketplace. This platform will host a wide variety of trading cards ranging from sports, to Pokemon and One Piece collectables. I'm leaning towards a design that is clean and modern. Key website features should include: - User Registration and Login: Applicants should be able to create personal profiles with ease, ensuring quick access to the trading card marketplace. This enables users to post their requests, of cards that might not be available in common markets and or post them with their desired value( Looking for X card for $$) ( Looking for X card graded with XX uploading a picture of demanded card....) - Card Posting and Searching: Users need the ability to post cards they're offering or seek...
...experienced Django developer to implement an access control system in our existing web application. The access control system will allow the super admin to define access levels and assign them to team members. Each access level will determine which parts of the application a user can access. Key Features: Access Level Management: Implement functionality for the super admin to create, edit, and delete access levels. Each access level should have customizable permissions for different parts of the application. User Management: Allow the super admin to add, remove, and manage team members. When adding a team member, the super admin should be able to assign an access level to them. Permissions Assignment: Implement a mechanis...
I am seeking a skilled video editor who can create an engaging and entertaining video. Regardless of the duration, the video's goal is to captivate the audience and provide a memorable experience. Key aspects of the projec...a product, but engaging and entertaining the viewer. Creativity and an understanding of how to keep an audience engaged is crucial. Ideal skills needed: • Proficiency in video editing software • Experience with motion graphics • First-hand experience in entertainment video production. • A keen eye for detail and a creative mind. • Excellent knowledge of timing and visual storytelling. Having access to a portfolio of previous work, particularly projects with an entertainment focus, would be a significant advantage in understandin...
Hello we are looking to make 2 simple changes to our shopify website order confirmation email. - We would like to add the product SKU in the email - We would like to make the product tile, image and sku clickable to it takes customer to the product page This is so when people need to reorder an item they can simply go to th...email - We would like to make the product tile, image and sku clickable to it takes customer to the product page This is so when people need to reorder an item they can simply go to their previous order confirmation email and click on the item or search it on the website by the SKU. We will send you the code and you will edit it and send back to us and we will paste it into shopify. No shopify access will be given. Looking to have this done immediately. $...
I need a skilled professional to assist with a data entry task. The project involves the following: - The task is primarily image data entry. - The images will be provided in digital photo format. - The entered data should be compiled into a database. Ideal candidates should have experience with data entry, particularly with image data. Proficiency in database management is also essential. A keen eye for detail to ensure accurate data entry is a plus.
I'm looking for an experienced...current Android versions. Key Requirements: - Develop front-end and back-end of the app - Implement in-app purchasing functionality - Ensure the app supports all current Android versions Data Management: - I prefer direct database access for content management - Utilizing third-party services for a more seamless and efficient data processing Ideal Skills: - Proven experience in Android app development - Proficiency in implementing in-app purchases - Strong understanding of both front-end and back-end development - Familiarity with managing data via direct database access and third-party services This project offers a great opportunity for a talented Android app developer to showcase their skills in creating a versatile a...
I'm looking for an experienced web scraper to access and download specific information and images from the Used Inventory section of the White Rock Honda website. Here are the specifics of what I need: - Car make and model - Year of the car - Price of the car For each car listing, I need ALL available images downloaded. Furthermore, I require the images in JPG format. Candidates applying should have successful experience in web scraping, data extraction, and handling myriad images. Efficiency and accuracy are critical for this project.
I am seeking a proficient Google Sheets expert to construct a live dashboard/leaderboard that visually represents daily sales tallies completed by individual sales reps. Key specifications: - Data to be pulled from a Master Google Sheet. - Incorporation of both total sales and individual rep sales. - The dashboard should display sales data for the current day while maintaining access to historical data. - Historical sales data should be visualized through a bar graph. Skills & Experience: - Attention to detail - Time management and delivery on tight deadlines - Proficiency in Google Sheets - Experience in creating dashboards. - Familiarity with data visualization and report generation - Strong analytical skills and precision Your ability to deliver this project efficientl...
I'm in need of an expert to assist with the cleanup of our Medicine database. The goal of this project is to accurately remove all duplicate entries improving the overall accuracy of the data. Ideal Skills & Experience: - Strong background in Database / Excel /CSV management, specifically in the medical field. - Proven track record of similar past work. In your application, please include details of similar projects you've worked on. Efficiency and precision are pivotal for this task. Looking forward to a neat and streamlined database!
...particularly leveraging AWS WAF, AWS IP Reputation, and AWS CloudTrail. Key Responsibilities: - Implement rigorous access control policies to ensure only authorized personnel can access our resources. - Configure and fine-tune AWS WAF to establish robust web application firewall rules, block specified IP addresses, and provide protection against DDoS attacks. - Set up and monitor AWS IP Reputation, ensuring that any malicious IP addresses are effectively blocked from our system. Skills and Experience: - Proven experience in implementing AWS security measures, particularly with AWS WAF, AWS IP Reputation, and AWS CloudTrail. - Strong understanding of encryption protocols and access control policies within AWS. - Experience with monitoring and logging tools to ensu...
I need a professional with experience in Odoo to implement accounting reports in Odoo saas~16.3+e (Enterprise Edition). The reports should be exportable as XLSX or CSV files. Required R...Display existing inventory as of a specific date. Price and cost information. 3-Sales Tax Display total sales within a specified time period. Consider both taxed and untaxed sales. Additional Features: *Ability to specify dates for the report results. Example: For the "Inventory Summary FEB 2024" report, be able to search for results for January or other previous months. Access and Meeting: Upon project acceptance, access to our Odoo system will be provided. A video call will be required for a brief orientation on how to obtain the reports Examples of the reports are attached a...
I'm looking for a proficient professional who can create a report in Microsoft Access from a MySQL database. The report should contain data from the MySQL database, calculations or summaries of data, visualizations or charts, and be structured as a paginated report, using SQL language. The report should be designed to be accessed as a printable PDF document. It is not required to be interactive, as a static report is sufficient for my needs. Key Requirements: - Proficiency in Microsoft Access, MySQL, VBA, PDF, Python, and Excel - Competency in SQL language for data manipulation - Experience in designing paginated reports The ideal candidate should have a proven track record of creating similar reports, with the skills and knowledge necessary to work wit...
I am searching for an experienced app developer who excels in designing and implementing Android-based applications. The main functionality required for this task is the creation of a comprehensive employee database system. Key Functionalities: • Instant tracking of employees' online and offline status • Storing and displaying contact details of each employee • Categorizing employees based on their department The developer should have a strong understanding of database structuring and management for Android systems and a proven track record of delivering similar projects. Familiarity with real-time data sync and user-friendly UI design are also desirable.
The ideal candidate will possess a comprehensive grasp of the intricate regulations surrounding the legal rights of individuals implicated in drug-related DUI charges, coupled w...the preference for blood over urine as the primary evidence in this context is pivotal, especially given the reliance on a faint immunoassay line for a substance consumed two days prior. Will be their defense during the lawsuit for my cicil right violations. Furthermore, uncertainty persists regarding the potentiality of a secondary mandatory test, with a hindrance named LIMS impeding the MRO's access. In any event, the decision to engage with the media on this narrative is clear. Please furnish a detailed account of your experience in the pharmaceutical domain and a summary of pertinent qualificati...
...apply. Key Responsibilities: Design and develop a user-friendly mobile application for iOS and Android platforms. Implement AI and NLP (Natural Language Processing) features for online interaction with users with future development for offline interactions. Integrate selective caching for offline access to critical conversation threads. Work with RESTful APIs for server-side features and NMEA (National Marine Electronics Association) data integration. Develop and manage a comprehensive database to handle user profiles, chat histories, and app analytics. Collaborate with UI/UX designers to ensure the app is intuitive and engaging. Ensure the application is compliant with all relevant maritime safety and communication standards. Optimize performance for smooth functional...
...interaction with AI. **Key Features:** 1. **AI-Generated Profiles:** We will use advanced AI generation algorithms to create profiles of virtual girls with whom users can interact. 2. **Empathetic Chat:** The AI will be capable of conducting empathetic and engaging conversations with users, creating an authentic and rewarding experience. 3. **Monetization:** We will offer users the opportunity to access premium and private content for a fee, ensuring a sustainable and profitable business model. 4. **Conversation Memory:** We will implement a system that allows the AI to remember users' past conversations, helping to build deeper and more personal connections over time. **Freelancer Goals:** We are looking for a highly skilled and creative freelancer to help us realize this...
I need assistance in compiling a large, extensive database of more than 5,000 working professionals earning a salary under 3 lakhs per annum. The data profile will include: - Name and contact details - Education and qualifications - Current job title and company Interestingly, these professionals should spread across various industry sectors such as Technology and IT, Healthcare and Medicine, as well as Marketing and Advertising. Particular skills and experience that would set freelancers apart for this job include: - Proven experience in data mining and data scraping - Familiarity with the mentioned industry sectors - Ability to accurately cross-reference and verify data - Excellent attention to detail Freelancers with extensive experience in maintaining data integrity and c...
For the described functionality, I will bill a total of 48 hours, amounting to $960 USD. Initially, I will bill for 24 hours. Upon completion of the work, I will bill the remaining 24 hours. Date of completion:- 24...contextually appropriate prompts & responses. Module 2: Quick Search IPC, Scopes The functionality for identifying IPC codes and defining scopes must be quick, efficient, and precise. Module 3: Document In-depth Analysis This module offers detailed feedback on patent drafts and drawings, addressing all patentability criteria effectively. User History Access A robust system for tracking and retrieving past submissions and work history to facilitate easy access for users. This feature will ensure that users can review and continue their previous work withou...
I'm in need of someone with the expertise, resourcefulness and knowledge to draw up an email lead list from public domain databases. The focus of this project is identifying professionals, specifically those with active websites for contact. Key requirements: - Extraction of email leads from public domain databases - Target demographic: Professionals of various walks with active websites - Experience with large-scale data extraction - Proficiency in managing information databases Your past work in email lead generation will be beneficial for the successful completion of this project. Your ability to provide clean, organized, and verified email lists will also be very important. Please only bid if you have the experience and know-how to deliver on the stipulated requirements.
I'm looking to hire an experienced web developer to create a website that caters to professionals. The main goal of this website is to provide information, so it will not require e-commerce capabilities. Key Features: - User Registration and Login: The website should have a user registration and login system to allow professionals to create their accounts and access specific content. - Search Functionality: A robust search functionality is crucial to help users easily find the information they are looking for. Target Audience: The target audience for this website is professionals. It is vital that the design and functionality of the website can cater to the needs and expectations of this demographic. Ideal Skills and Experience: - Proficient in web development and design, w...
I need to create a console project in C# Net Framework that I can listen the data from an equipment Mindray BC-20s and / or BC-30s. Using Ethernet configuration and HL7. The data that comes from the clinical equipment needs to be save it on txt file. The configuration is using TCP/IP and I need - Port for every equipment Any questions? I made a console project but I could no be able to get the results from those equipments. I need a person who had been working with HL7.
I am seeking a developer to create an in-depth offline property abbreviation dictionary portal, accessible as a desktop or mobile application, allowing users to easily search and access property-related abbreviations and their full meanings without requiring an internet connection." Key requirements: ▪︎ The website should provide comprehensive word definitions ▪︎ Include abbreviations and provide their full definitions ▪︎ Both word definitions and abbreviations must be thoroughly explained Ideal Skills: ▪︎ Proficiency in website development ▪︎ Experience in creating educational resources or similar platforms ▪︎ Excellent command of the English language ▪︎ Attention to detail, ensuring accuracy and completeness of every word definition and abbreviation. Through this platf...
...executives' names, etc. • Take pictures of the subject company and its vicinity, as per Confirmis’ standard operating guidelines. • Provide observation about the company to gauge activeness, e.g., staff working at the premise, loading/unloading of goods, etc. REQUIREMENTS: • Must be living in (or nearby) Av. Mariscal Nieto, Lima, Peru. • Has a camera or phone/tablet of quality with a camera, internet access • Must be available during business hours (9 AM - 4 PM) on working days Please see the attached file for the site visit guidelines. You are only required to deliver the pictures, video & observations and are not expected to put together a report like the Sample Report. Note: Milestone will be released the following week after the site...
Project Brief: Dental Lab Websi...clients to pay for their orders online, with support for major credit cards and digital wallets. Responsive Design: A mobile-friendly website layout that adjusts seamlessly across various devices and screen sizes. SEO and Content Strategy: Implementation of SEO best practices to improve search engine rankings, along with engaging content that positions us as industry experts. Customer Support: Easy access to customer support, including live chat, phone, and email contact options. Deliverables: A fully functional prototype of the website for initial review. Integration of all specified features post-approval of the prototype. Testing and quality assurance to ensure a bug-free user experience. Deployment of the website on a secure and reliable hosting...
