Access vba project vb net converter punët
Qysh je qa bone deshta me te pyt a din me mnimu ne ReactJS me bo 1 searchbox me hooks qe ka access ndatabase(firebase). vetem kjo funcionality po mvyn me shtu.
Qysh je qa bone deshta me te pyt a din me mnimu ne ReactJS me bo 1 searchbox me hooks qe ka access ndatabase(firebase). vetem kjo funcionality po mvyn me shtu.
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
I'm looking for a proficient professional who can create a report in Microsoft Access from a MySQL database. The report should contain data from the MySQL database, calculations or summaries of data, visualizations or charts, and be structured as a paginated report, using SQL language. The report should be designed to be accessed as a printable PDF document. It is not required to be interactive, as a static report is sufficient for my needs. Key Requirements: - Proficiency in Microsoft Access, MySQL, VBA, PDF, Python, and Excel - Competency in SQL language for data manipulation - Experience in designing paginated reports The ideal candidate should have a proven track record of creating similar reports, with the skills and knowledge necessary to work with the s...
The ideal candidate will possess a comprehensive grasp of the intricate regulations surrounding the legal rights of individuals implicated in drug-related DUI charges, coupled w...the preference for blood over urine as the primary evidence in this context is pivotal, especially given the reliance on a faint immunoassay line for a substance consumed two days prior. Will be their defense during the lawsuit for my cicil right violations. Furthermore, uncertainty persists regarding the potentiality of a secondary mandatory test, with a hindrance named LIMS impeding the MRO's access. In any event, the decision to engage with the media on this narrative is clear. Please furnish a detailed account of your experience in the pharmaceutical domain and a summary of pertinent qualificati...
...and the ability to work independently on a project from conception to launch. I am located in the Eastern Time Zone of the United States and if you are located elsewhere, you must be able to work with us when needed from 1 PM to 12 AM (New York - ET). Individuals seeking this position should only apply and sales reps or business development reps should not apply. We are only seeking to work with one to three people maximum and agencies should not apply. Key Responsibilities: Design and develop a user-friendly mobile application for iOS and Android platforms. Implement AI and NLP (Natural Language Processing) features for online interaction with users with future development for offline interactions. Integrate selective caching for offline access to critical conversa...
**Title:** AI-Based Dating Platform Development Project **Introduction:** Welcome! We are excited to present to you an exciting development project for an innovative and cutting-edge dating platform. Our mission is to revolutionize the online dating experience using artificial intelligence to create meaningful and authentic connections. **Project Objective:** Our goal is to develop a dating platform similar to , where users can interact with AI-generated profiles and engage in compelling and empathetic conversations. The platform must be able to charge users for private content and promote genuine emotional connections through interaction with AI. **Key Features:** 1. **AI-Generated Profiles:** We will use advanced AI generation algorithms to create profiles of virt...
I'm in need of a .NET developer with varied experience on the framework. The project requires multiple functionalities such as database integration, user authentication, and third-party API integration. Your application should demonstrate your past work in .NET, as well as your experience in the field. Please provide a detailed project proposal to give an idea of how you plan to approach this project. If you're well-versed in the .NET Framework 4.0, 4.5 or 4.8, this could be a great opportunity for you.
...the high standards for each module to ensure the project is exemplary and ready for public showcasing: Module 1: Idea to Well-Crafted Invention - Patent Draft Report Generation All reports should be polished, error-free, include high-definition visuals, and provide accurate, dynamic, contextually appropriate prompts & responses. Module 2: Quick Search IPC, Scopes The functionality for identifying IPC codes and defining scopes must be quick, efficient, and precise. Module 3: Document In-depth Analysis This module offers detailed feedback on patent drafts and drawings, addressing all patentability criteria effectively. User History Access A robust system for tracking and retrieving past submissions and work history to facilitate easy access for users. This fea...
As a professional with high-volume data, I'm seeking a highly skilled Excel expert. You should have proficiency in: - Data analysis - Data visualizati...a professional with high-volume data, I'm seeking a highly skilled Excel expert. You should have proficiency in: - Data analysis - Data visualization - Excel formulas, functions and macros - Visual Basics Application (VBA) I'm dealing with more than seven datasets, each one having high complexity (many columns and over 5000 rows). I will need your expertise in managing and understanding this data. Ability to quickly comprehend and adjust to new data structures would be advantageous. Proven experience with large data sets and advanced Excel usage is a must for this project. Please include examples of previou...
I'm looking to hire an experienced web developer to create a website that caters to professionals. The main goal of this website is to provide information, so it will not require e-commerce capabilities. Key Features: - User Registration and Login: The website should have a user registration and login system to allow professionals to create their accounts and access specific content. - Search Functionality: A robust search functionality is crucial to help users easily find the information they are looking for. Target Audience: The target audience for this website is professionals. It is vital that the design and functionality of the website can cater to the needs and expectations of this demographic. Ideal Skills and Experience: - Proficient in web development and design, w...
I need to create a console project in C# Net Framework that I can listen the data from an equipment Mindray BC-20s and / or BC-30s. Using Ethernet configuration and HL7. The data that comes from the clinical equipment needs to be save it on txt file. The configuration is using TCP/IP and I need - Port for every equipment Any questions? I made a console project but I could no be able to get the results from those equipments. I need a person who had been working with HL7.
I am seeking a developer to create an in-depth offline property abbreviation dictionary portal, accessible as a desktop or mobile application, allowing users to easily search and access property-related abbreviations and their full meanings without requiring an internet connection." Key requirements: ▪︎ The website should provide comprehensive word definitions ▪︎ Include abbreviations and provide their full definitions ▪︎ Both word definitions and abbreviations must be thoroughly explained Ideal Skills: ▪︎ Proficiency in website development ▪︎ Experience in creating educational resources or similar platforms ▪︎ Excellent command of the English language ▪︎ Attention to detail, ensuring accuracy and completeness of every word definition and abbreviation. Through this platf...
2 excel files with VBA macro as per customer requirement
...executives' names, etc. • Take pictures of the subject company and its vicinity, as per Confirmis’ standard operating guidelines. • Provide observation about the company to gauge activeness, e.g., staff working at the premise, loading/unloading of goods, etc. REQUIREMENTS: • Must be living in (or nearby) Av. Mariscal Nieto, Lima, Peru. • Has a camera or phone/tablet of quality with a camera, internet access • Must be available during business hours (9 AM - 4 PM) on working days Please see the attached file for the site visit guidelines. You are only required to deliver the pictures, video & observations and are not expected to put together a report like the Sample Report. Note: Milestone will be released the following week after the site...
Project Brief: Dental Lab Website Development Objective: To create a comprehensive and user-friendly website for [Dental Lab] that showcases our dental lab services, highlights our car cam milling center, and offers a seamless online ordering experience for other labs and dentists. Key Features: Service Representation: A detailed section showcasing our range of services, including custom dental prosthetics, orthodontic appliances, and our specialized car cam milling services. Online Order Form: An intuitive and secure form that allows clients to easily place orders, with fields for specific requirements and preferences. File Upload Capability: A secure portal for clients to upload digital impressions or design files, supporting multiple file formats. Payment Gateway Integration: A r...
I'm looking for freelancers to help me secure backlinks from guest posts. If you have access to website DA 60+ in Ahrefs, you can quote your price per guest post. Look, I already have contributors working on it, so, don't just quote in a silly manner, reasonable prices will be accepted. Criteria: -60+ DA in Ahrefs -Must be indexed by Google, only pay for indexed posts. Thank you.
Título del proyecto: Aplicación de registro digital de parte de anestesia Descripción: Se requiere una aplicación móvil multiplataforma desarrollada en .NET MAUI que permita el registro digital de un parte de anestesia. La aplicación debe ser capaz de conectarse a una cámara a través de Bluetooth o Wi-Fi para tomar fotos cada cierto intervalo de tiempo (por defecto, cada 3 minutos) y utilizar OCR o IA para interpretar y obtener los signos vitales del paciente (frecuencia cardíaca, saturación de oxígeno, tensión arterial, etc.) a partir de las fotos tomadas. La aplicación deberá generar un gráfico de línea de tiempo donde se representen los signos vitales en el eje Y y la...
...to assist me with comprehensive research. Specifics: - Your expertise in Social Sciences is of essence and shall be fundamental in this project. - I require assistance in extracting relevant studies from top-tier UK or USA journals. Familiarity and access to vast academic journals are absolutely necessary. - I'm focused on qualitative research and expect appropriate methodologies to be applied in this study. -I require that the writer must not use AI generated text or sources. AI sometimes CREATES references that do not exist! Only true writers may apply please. Skills required: - Extensive experience in Social Sciences. - Should have privileged access to premium academic journals in UK and USA - Familiarity with qualitative research methodologies. - An ab...
...member data from Excel sheets. Enable different access levels (Project team, Donors and trading partners) for viewing, analysis and with rights editing member profiles. Membership Subscription Tracking Design a system to track membership subscriptions and payments. Record subscription start dates, renewal dates, and payment history. Allow for online subscription tracking with the flexibility to transition to offline tracking based on user capacity. Member Services Tracking Develop modules to track member services such as training sessions attended, donations received, and other relevant services provided. Capture details of services rendered and associated dates for reporting and analysis. Implement data import capabilities and offline access options for managing...
...engaging, and visually appealing. Additionally, the project extends to the development of multiple ecosystems comprising specific product pages. Each of these pages will be linked to several subpages outlining the services related to that particular product. Key features to include in the different service pages are: - Detailed service descriptions - Customer testimonials - Booking links. -Connections to payment funnels via ThriveCart Your ability to combine creativity and technical proficiency will let you deliver a platform that not only meets our audience's needs but also reflects our commitment to quality service. Experience in building dynamic, interactive web pages is extremely valuable for this project. We will start with one project and see how quic...
I'm seeking a talented machine learning expert to create a model to predict cancer - related...Requirements: - No Data Availability: You will be responsible for sourcing a suitable dataset for this project. The dataset should be substantial, relevant to healthcare, and appropriate for predictive analysis. - Designing, Implementing and Evaluating a Strategy. - Evaluation of the Model - Making predictions on a New Test Set Ideal Candidate: - Strong Machine Learning Skills: You should have a proven track record in creating predictive analysis models. - Healthcare Industry Knowledge: Little experience in working with healthcare datasets would be a significant advantage. - Data Sourcing Ability: Being able to identify and access appropriate datasets is crucial for the su...
I currently have a website set up. Users are able to register/login and are redirected to a My account page. On this My Account Page I need users to be able to upload Pics/videos add a short description and submit. Once submitted I need the posts to go to a user specific "My Documents" page that only the user and admin can access.
...and rented out. Key requirements: - Designing the platform to be responsive, enabling users to access and interact with it from various devices. - Tenant will only request for booking and Booking should confirm only by landlord. After confirmation tenant should be able to book. -Calendar Integration: A feature that enables tracking of room occupancy to prevent double booking. - Implementing an inventory management system that will enable me to monitor the availability of items in rooms at the hotel. - Including a functionality to monitor any defects that might occur in the rooms. - Inventory Maintenance: A system to monitor room conditions, track possible defects, and status of rooms. The project does not require integration with any payment methods. The primary focus i...
I am working with GridCore library from .NET Core. I am having issues getting the column headers to be displayed with the filters added. Now, I am only able to display the column headers titles. I need someone that has proven experience using this library and can give me the solution.
I'm seeking a skilled Laravel developer to resolve a stubborn issue we are encountering on our video subscription website. Subscribed users are currently unable to access any videos on the site, and we need this fixed urgently. Key tasks: - Identification and resolution of the subscription issue preventing user access to all videos - Ensuring that only subscribed users have uninterrupted, total access to our video content. Ideal experience and skills: - Extensive background in working with Laravel - Proficient at troubleshooting and resolving subscription and accessibility issues - Prior work with video streaming platforms would be a strong advantage. Your main duty will be to restore functionality swiftly, ensuring our subscribed users' seamless intera...
...will present additional products or offers with a one-click option. This feature is particularly tailored for customers who choose cash on delivery as their payment method. 5). Order Bump Feature: The ability to offer additional products or services at the checkout page with a checkbox for customers to easily add them to their order. 6). Access Control (Blacklist/Whitelist from Certain Countries): Implementation of access control to restrict or allow access to the website based on specified countries. This can include both blacklisting and whitelisting. 7). Support Google/Meta/Snapchat/TikTok Pixels: Integration with various tracking pixels (Google, Meta/Facebook, Snapchat, TikTok) for marketing and analytics purposes. 8). Support WhatsApp Messages or SMS After Purc...
I am looking for prooven track profesional to manage and improve mi dropshipping store in health&wellnes,cosmetics store,EU and SUA market trending&winning products,content writing,ads campaigns set up will be 50% of net income, of sales.
I am currently facing a challenge with my website, Kenoshaquilting.net. Attempts to access the page without www. are returning 404 error messages. This is predominantly affecting the Home page, Contact page, and About page. Even though I'm unsure if a redirect from the non-www version to the www version of the website has been set up, I do have access to the website's hosting server. The ideal freelancer for this job should have: - Extensive experience dealing with 404 errors - Solid understanding of website redirects - Proficiency in backend website management - Immediate availability Your task will include: - Identifying and fixing the sources of the 404 errors - Setting up a successful redirect from the non-www version to the www version of the site - Ensuring...
...executives' names, etc. • Take pictures of the subject company and its vicinity, as per Confirmis’ standard operating guidelines. • Provide observation about the company to gauge activeness, e.g., staff working at the premise, loading/unloading of goods, etc. REQUIREMENTS: • Must be living in (or nearby) Tuas Avenue 16, Singapore. • Has a camera or phone/tablet of quality with a camera, internet access • Must be available during business hours (9 AM - 4 PM) on working days Please see the attached file for the site visit guidelines. You are only required to deliver the pictures, video & observations and are not expected to put together a report like the Sample Report. Note: Milestone will be released the following week after the site visi...
I'm planning a community app. Users should be able to register in this app (email + password, Google, Facebook, etc.). In addition, the user should be able to create a small profile, e.g. with photo, location, nickname. Registration via email + password must be confirmed via double opt-in. The app should be able to access the device's contact lists. Now the user can create a new thread. In this he enters the following information: - Message part 1 (public) - Message part 2 (not public) - Recipient - Date The recipient (from the existing contacts, or an individual entry, e.g. telephone number or email) then receives a message via internal private messaging (if the recipient is also logged in to the app), SMS or, if known, via email. If the notification is sent via ema...
...transaction ledger are incorporated to educate players on financial management and security. 3. *Sustainability Rewards System:* - Engage in eco-friendly farming practices like water conservation and organic cultivation to earn extra BABYCHICKEN tokens. - Environmental quests and green achievements encourage players to learn about and contribute to ecological sustainability. 4. *Worldwide Access and Diversity:* - Cross-platform play allows for a diverse global community to interact without geographic or financial barriers. - Multilingual support and culturally diverse content ensure an inclusive environment for all players. 5. *Innovation and Creativity Hub:* - Players are challenged to design inventive farming solutions and upgrades, with the best ideas rewarde...
Hola Necesito una API web muy sencilla en .NET únicamente que reciba un JSON con datos fiscales y utilice OAuth 2.0 debo de ser capaz de correrlo en mi equipo como localhost y hacer pruebas desde postman
I'm facing some DNS and Active Directory related issues on our on-premises servers. I need an expert who can delve into the root of the problem and resolve these issues for us. Your main tasks would include: - Checking DNS configurations. - Verifying Active Directory replication. You will be provided with full administrative access to the servers to ensure that you have everything you need to identify and solve the problems. Your expertise in these areas will be crucial to our operations.
One excel file with macro as per the customer requirement
I want a platform using binance APIs and web sockets to collect real time data and calculate the values and show in the form of heatmap using plotly heatmaps. I need 4 features. Liquidation heatmap, order book, net position heatmap and liquidation level. Ideally Pakistani developer (for easy communication). Refer to attached requirement
...and percentage for website owner. Admin area must have full control of website , music, songs, etc. Website must have a DCMA report function that reports copyright issues to the admins. Sales System: - A custom sales system must be developed and incorporated to manage digital music sales. - This system should enable direct downloads after purchasing tracks. - Allow customers to have lifelong access to their purchased files anytime. - It should have a secure downloads area to prevent unauthorised downloads. - Comprehensive sales analytics for artist and site owner use will also be needed. Sales must be done using stripe or paypal. Ideal skills/Special Requirements: Strong expertise in Web Development, UI/UX design, Database Management, E-commerce solutions, and Secure Digita...
Looking for an experienced DevOps Engineer to set up & document a 3-node HA Vault cluster (Linux Ubuntu) using Docker Compose (not Swarm, not k8s) with Consul as the storage backend (plus ensuring SSL/TLS self-renewing certs & snapshotted backups to an S3 bucket (on ) every time a new policy or secret added). You'll get sudo-level account access on all nodes which are already up and running on Contabo. You'll need to use the latest versions of Docker & Docker Compose. Your Experience + Multiple Docker-based Vault cluster deployments + Proficiency in Linux shell scripting and Docker Compose + Ability to document setup process clearly disaster recovery Summary acceptance criteria + I follow docs & rebuild cluster & recover existing backup + I retrieve...
...goal of this setup is to enable site-to-site connectivity in a secure manner. This project requires a unique approach to access control; this will be managed based on data stored in a MongoDB database. Key Responsibilities: - Configure an OpenVPN server on a Linux machine for site-to-site connectivity. - Implement routing based on MongoDB database records. Ideal Skills: - Proficient in Linux server setup and configuration. - Experience in OpenVPN server setup, particularly for site-to-site connectivity. - Familiarity with MongoDB, especially in integrating it with server configurations for access control. - Strong networking skills to ensure proper routing and connectivity between VPN endpoints. This project requires someone who can bring a strong mix of...
... (EST preferred). The key content to share are following: 1. Deals from our website. (Any deals you may find interesting, or currently trending products in the world/networks via a link from our website) via text and images 2. Deals and posts from our affiliate partners 3. Polls 4. Very basic videos of products or storytelling, you can edit yourself or use help of , we will provide access. 5. Responding to user engagement The objective is to grow the social channels, increase engagement and drive more traffic to our website. Crafting engaging and relevant content tailored to each platform is super important. Automating tasks would be a big advantage although not necessary. You will need to keep track of posts in a spreadsheet that will include: time of post, length of content
Attention, everyone! As we gear up to unveil our latest product, a subscription-based signal service, we're in need of a promotional video to captivate audiences across YouTube, TikTok, Instagram, and Twitter. (keep this in mind fo...easily sniping (buying) and selling new coins. Subscribe to O/p/e/s/S/i/g/n/a/l/s and automatically receive the best signals, which you can then automatically forward to the Maestro bot to execute buy and sell orders automatically 24/7. This means you never have to worry about missing out on a new coin that might skyrocket x200 or even higher! We believe in transparency and therefore provide ample access to all historical data we have, including both losses and profits made. -- We used forward slash in our brand name so it doesnt show up in ...
...seeking to access capital markets. Additionally, I need help in the following: - Securing a domain name that is suitable for my business and easy for clients to recall. - Setting up a professional email address for the business that enhances my credibility with clients. Ideal skills and experience for this job include: - Proficiency in web development with a portfolio of financial or advisory websites - Knowledge of domain registration and email setup - Prior experience working with consultancy or financial services businesses - Strong understanding of SEO and lead generation principles Please include in your bid any additional services you can provide such as ongoing maintenance or support. I primarily work with startups and small to medium-sized enterprises to help them ...
...help me restore my WordPress website. I had a fully functional site initially, but after my membership ended, it seems like the website is no longer accessible. Unfortunately, I don't have a backup of the site. The key tasks for this project are: - Restoring the website to its original state - Fixing the issue with access due to the membership end - Ensuring the site is fully operational and accessible Ideal skills for this project include: - Proficiency in WordPress website management and restoration - Experience in fixing issues related to membership access - Understanding of website back-up procedures and recovery - Excellent problem-solving and communication skills - A keen eye for detail and quality assurance Your role will be critical in ensuri...
We need a professional press release to announce a new...Middle East organisation based in Egypt. The target audience will be potential investors and distribution through various media outlets in both regions. Key Requirements: - The press release will need to contain background information mainly on the Canadian company and emphasize the finacial benefits of the partnership in a compelling manner. - The tone needs to be engaging and tailored to a high net worth individuals and financial professionals operating mainly throughout the middle east region. Ideal Skills: - Proven experience in writing press releases for finance industry. - Understanding of Middle East culture. - Arabic language a great asset - Strong copywriting skills and ability to convey complex ideas in a conci...
I need assistance with building my real estate website. It's already built but I need someone to set up the following: - Integrating IDXBroker for home listings. - Configuring Ulisting and Impress for showcasing homes. I will provide all necessary credentials and access for integrating IDXBroker and configuring Ulisting and Impress. Please note, I have not decided on a specific design or layout for the website, so I would appreciate some suggestions on this front.
Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.