Asp net vb net paypal site punët

Filtër

Kërkimet e mia të fundit
Filtro sipas:
Buxheti
deri në
deri në
deri në
Lloji
Aftёsitё
Gjuhët
    Shteti i punës
    2,000 asp net vb net paypal site punët e gjetura, me çmimin EUR
    Produkt kozmetike -- 2 Ka përfunduar left

    Projekti: Përkthim i një broshure reklamuese për një produkt të ri kozmetik në gjuhët angleze dhe gjermane. Përshkrimi i projektit: Kërkoj një përkthyes profesional për të përkthyer një broshurë reklamuese për një produkt kozmetik të ri në gjuhët angleze dhe gjermane. Broshura përmban rreth 1000 fjalë dhe kërkoj që përkthyesja të jetë në g...përkthim të besueshëm, të saktë dhe të qartë për të siguruar që produkti të shitet me sukses në tregjet anglisht dhe gjermanisht. Afati kohor: Afati i projektit është 10 ditë nga pranimi i projektit. Shërbimet që ofrohen: P...

    €17 / hr (Avg Bid)
    €17 / hr Oferta mesatare
    9 ofertat
    Produkt kozmetike Ka përfunduar left

    Projekti: Përkthim i një broshure reklamuese për një produkt të ri kozmetik në gjuhët angleze dhe gjermane. Përshkrimi i projektit: Kërkoj një përkthyes profesional për të përkthyer një broshurë reklamuese për një produkt kozmetik të ri në gjuhët angleze dhe gjermane. Broshura përmban rreth 1000 fjalë dhe kërkoj që përkthyesja të jetë në g...përkthim të besueshëm, të saktë dhe të qartë për të siguruar që produkti të shitet me sukses në tregjet anglisht dhe gjermanisht. Afati kohor: Afati i projektit është 10 ditë nga pranimi i projektit. Shërbimet që ofrohen: P...

    €30 / hr (Avg Bid)
    €30 / hr Oferta mesatare
    2 ofertat
    €28 Oferta mesatare
    1 ofertat

    njerëzit kanë të drejtë të vendosin baste live

    €510 (Avg Bid)
    €510 Oferta mesatare
    3 ofertat

    Pershendetje, kam pyetje per krijim te aplikacionit IOS dhe Android. ...një gamë të çmimeve bazë për ato. Ne si kompani e dimë se çdo projekt është unik. Gjithsesi, është e rëndësishme të njohim një gamë të çmimeve bazë të disa aplikacioneve bazë si: Shembulli 1: 1) Dyqani Online me rreth 100 produkte 2) Dizajn korporativ është prezent nga kompania 3) Metodat e pagesës: PayPal, Creditcard Shembulli 2: 1) Rezervimi i aplikacionit për një restorant apo hotele 2) Mundësitë e rezervimit (rezervimi i një tavoline, rezervimi i një dhome) 3) Metodat e pagesës: PayPal, Creditcard Pyetje të tjera janë: A ...

    €1970 (Avg Bid)
    €1970 Oferta mesatare
    4 ofertat
    Programing Ka përfunduar left

    Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc

    €11213 (Avg Bid)
    €11213 Oferta mesatare
    4 ofertat
    Crie um Website Ka përfunduar left

    Desenvolvedor .NET MVC, SQL e ADVPL Protheus

    €2723 (Avg Bid)
    €2723 Oferta mesatare
    1 ofertat
    qefqreqweqawdafsc Ka përfunduar left

    asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr

    €184 (Avg Bid)
    €184 Oferta mesatare
    1 ofertat
    Créez un site Web mobile Ka përfunduar left

    our life drftyguhijoklp^mlpokijhgyfdfghjkl

    min €4634
    min €4634
    0 ofertat

    Desgin an Admin Theme for simple HTML Web Site

    €25 (Avg Bid)
    €25 Oferta mesatare
    4 ofertat
    yveguwvcjnjnecbkhb Ka përfunduar left

    ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif

    €105 (Avg Bid)
    €105 Oferta mesatare
    1 ofertat

    I've already secured a Wordpress template and I need a specialist to deploy it on my GoDaddy hosting. Though I've skipped over specifying the functionalities, I am open to suggestions that will enhance my site's user experience, keeping in mind, it will be a business platform. ...functionalities, I am open to suggestions that will enhance my site's user experience, keeping in mind, it will be a business platform. Ideal Skills and Experience: - Proficiency in Wordpress - Know-how of GoDaddy hosting - Ability to suggest and add relevant functionalities The goal is to ensure smooth deployment, with no disruption to site performance or loss of data. Kindly include in your bid any critical items I may have missed out and your ideas to improve the site. The...

    €112 (Avg Bid)
    €112 Oferta mesatare
    187 ofertat

    I'm in need of a skilled web developer to construct an e-commerce website targeted towards professionals. This online platform is essential for selling physical goods. Key Requirements: - Proficient in e-commerce website development - Ability to design a professional and user-friendly interface - Experience in setting up secure payment systems - SEO optimization skills essential Understanding of the professional target market and innovative design thinking would be highly appreciated. The website should be easy to navigate, fast, secure, and appealing to professionals. The freelancer should possess the ability to integrate inventory management systems and provide support for potential issues or improvements. Prior experience with similar projects will be an asset.

    €136 (Avg Bid)
    €136 Oferta mesatare
    214 ofertat

    buenas tardes, quisiera realizar un sitio web con 2 páginas internas ( una de inicio y otra para los 3 productos ) Tambien necesitamos que tenga instalado plugins recomendados mas Google Pay, Apple Pay, Stripe y PayPal.

    €45 (Avg Bid)
    €45 Oferta mesatare
    82 ofertat

    ...developer who could significantly improve an existing Android application built on .NET with SQL backend. Major tasks include: - Redesigning UI/UX to make the app more intuitive and user-friendly - Adding more interactive elements to keep users engaged - Improving navigation for a flawless user experience - Identification and fixing of bugs, coupled with performance optimizations for a smooth application flow - Integration of new features such as push notifications, in-app messaging, and creation of 'Course Sections', Course Notes Section - Reworking of the 'Find Jobs' section to make it more efficient - And with complete new Login and Sign pages. Ideal freelancer should have: - Extensive experience with .NET, SQL, and Android app development - Pr...

    €294 (Avg Bid)
    €294 Oferta mesatare
    9 ofertat

    Hi, Looking for a freelancer who take a site visit and confirm about a site, Just a site visit project and check address validation, ongoing work in future, further discus about task after freelancer response. more information will be provided to the selected freelancer.

    €9 - €28
    Lokale
    €9 - €28
    0 ofertat

    Srs. Preciso fazer a comunicação com o banco de pagamentos Efí, cartão, pix, boleto via API. No site do banco tem os esquemas para conexão com diversas linguagens, mas preciso passar para ASP CLASSIC ou fazer com que meu site que está em ASP trabalhe com as informações vindas. - Tentei com oXMLHTTP = mas deu alguns erros. - Acho que estou errando em alguma linha de código. - Se for possível fazer a comunicação com Jquery também seria uma boa.

    €137 (Avg Bid)
    €137 Oferta mesatare
    31 ofertat

    I'm looking for an experienced web developer to build a user-friendly, efficient, and robust second-hand fashion marketplace. Key Project Requirements: - Integration with specific brands: Brand A, Brand B, and Brand C. Your experience in delivering brand integrations is crucial. - Payment gateway integrations: My platform needs to accept PayPal, MBWay, and Credit Card payments. Proven track record in similar integrations is expected. - Feedback system integrations: We'd like a system where buyers and sellers can easily rate and review each other. Preferred Skills and Experience: - Proven experience in developing online marketplaces - Expertise in payment and brand integration - Understanding of effective feedback systems within online marketplaces. I'm expect...

    €2093 (Avg Bid)
    €2093 Oferta mesatare
    148 ofertat

    Hi, Looking for a freelancer who take a site visit and confirm about a site, Just a site visit project and check address validation, ongoing work in future, further discus about task after freelancer response. more information will be provided to the selected freelancer.

    €9 - €28
    Lokale
    €9 - €28
    0 ofertat

    I am in need of an expert to upload PHP to a Hostingger server, install a Domain Validation SSL, and ensure that my corporate website is functioning smoothly. Key Aspects: - Install PHP on Hostingger server - Implement Domain Validation SSL on the website - Optimize for a smooth run of a corporate website Aside from setting up the basics, I also require specialized security features for the PHP part of my website. You should have extensive experience in programming and security handling. Skills and Experience: - Proficiency in PHP coding and security customizations - Expertise in Operating Hostingger Server - Experience in Domain Validation SSL Installation - Knowledge on corporate websites dynamics

    €15 (Avg Bid)
    €15 Oferta mesatare
    20 ofertat

    More details: Developing a prototype to present to other companies. Need completed within a month. Please include your experience and past work.

    €986 (Avg Bid)
    €986 Oferta mesatare
    261 ofertat

    ...economies. As a Site Verifier, you will be responsible for verifying a company’s existence through visual data by conducting a site visit to ensure that we provide reliable and accurate information to our client. JOB DESCRIPTION: • Conduct basic verification with the subject company’s authorized representative, such as line of business, key executives' name, etc. • Take pictures of the subject company and its vicinity, as per Confirmis’ standard operating guidelines. • Provide observation about the company to gauge activeness, e.g., staff working at the premise, loading/unloading of goods, etc. REQUIREMENTS: • Must be living in (or nearby) Tangier, Morocco • Has a camera or phone/tablet of quality with a camera, inter...

    €23 - €37
    Lokale
    €23 - €37
    0 ofertat

    I encountered an issue with the PayPal button on my site. what i want is : once the user fill 2 edit fields (wallet and amount ) the content of the 2 edit fields should be sent to a given email address after a successful payment. that's it. attached to this description you will find the html-file with the information i talked about. the max budget for this small task is $10. thank you

    €18 (Avg Bid)
    €18 Oferta mesatare
    69 ofertat

    Hi, i am Using Ghost as a CMS with Static pages Site and like to Generator and Deploying to Cloudflare Pages. the work: static HTML files you could use an automation deployment workflow using Netlify . linking my Ghost installation and adding the repo to Netlify this can host static files in the same way you were on GitHub Pages, but the static files would be automatically redeployed whenever I make a change in your Ghost content with the use of webhooks. more info on how to do it ca be found at:

    €19 (Avg Bid)
    €19 Oferta mesatare
    4 ofertat
    Viva API Integration for WIX Site 6 ditë left
    VERIFIKUAR

    I'm in need of a developer who can manually create and integrate the Viva API into my Wix website. The ideal candidate for this project would have a deep understanding of integrating APIs and payment processing systems, as well as experience working with Wix. Key Requirements: - Establish secure payment processing, specifically for Credit Card and Debit Card options through the Viva API. - Design a simple, clean payment processing page that aligns with my current website design. - Subject the new integration to testing to ensure it works seamlessly and securely. Please only apply if you have experience with similar projects and can provide examples of your work. The successful candidate should get this done with minimal debugging needed, due to their insightfulness and expertise.

    €78 (Avg Bid)
    €78 Oferta mesatare
    15 ofertat

    I'm in the process of starting a coffee shop and need a specialised website developer to build an interactive e-commerce website for my business. Ideally, I'm looking for someone who can blend creativity and technical skills to provide a seamless online ordering system catering to my customer's needs. Key responsibilities: - Conceptualising, developing, and implementing an engaging e-commerce platform - Integrating an efficient online ordering system for ease of transactions Applicants should: - Have proven experience in e-commerce website development - Possess strong technical skills, with an emphasis on integrating online ordering functionalities - Be able to share detailed project proposals outlining how you can meet my specific requirements. This should include the s...

    €254 (Avg Bid)
    €254 Oferta mesatare
    56 ofertat

    We are on the hunt for a dynamic and experienced Web Designer who can proficiently work with both Wix and WordPress platforms. The main purpose of our website is to sell products/services online. Our ideal website should have the following functionalities: - Online payment system: with seamless and secure transactions for customers - Product catalogue: presented in an easily navigable, aesthetically pleasing format - User accounts: personalized and secured for an engaging shopping experience The ideal candidate should have activities related to building commercial websites and must exhibit the right expertise in managing Wix and WordPress sites including design, customization, and maintenance. Knowledge of e-commerce trends and excellent understanding of online payment systems, produc...

    €6 / hr (Avg Bid)
    €6 / hr Oferta mesatare
    42 ofertat

    I'm looking for an experienced WordPress developer to craft a subscription plan for my website, focusing specifically on digital music downloads using python. Your job will involve the following tasks: - Implementing a robust subscription system onto my existing WordPress website, which allows users to engage in direct download of the music files they have subscribed to. Subscription plans will roughly be; free trial user (no downloads), single download is $10, subscription 1 (2 downloads per month $16.99), subscription 2 ( 12 downloads per month $89.99), and subscription 3 (75 downloads per month $499) - User information that will be gathered during the subscription process and a label will be placed on user dashboard with download balance remaining. - Implement this feature whil...

    €138 (Avg Bid)
    €138 Oferta mesatare
    89 ofertat
    1-Page Shopify Site Design 6 ditë left
    VERIFIKUAR

    I'm looking for a skilled Shopify designer with 3-5 years of experience and proficient in HTML/CSS to create an engaging 1-page site for my clothing brand in three days. Your main task will be to design a platform for showcasing and selling our clothing products. Unfortunately, I didn't specify any special features but the focus should be a clean, user-friendly design that makes our items stand out. If you can deliver within the tight deadline with a budget of $40, I would be thrilled to work with you! Let's create something amazing together.

    €108 (Avg Bid)
    €108 Oferta mesatare
    227 ofertat

    I'm in need of an experienced .NET/Angular developer who can build me an e-commerce website. Your task will primarily involve: - Creating a User registration and login system. - Establishing Product search and filtering capabilities. - Implementing a Shopping cart and checkout system. Moreover, it's essential for the website to support different payment methods. These should include: - Credit/Debit cards - PayPal - Bank Transfers This project will require someone with a proven track record in developing responsive and user-friendly e-commerce websites. Knowledge of .NET API and Angular are non-negotiable. If you have these skills and can complete this project ASAP, please get in touch.

    €156 (Avg Bid)
    €156 Oferta mesatare
    11 ofertat

    I am seeking a team of skilled freelancers who are proficient in a diverse range of programming languages. Key skills ideal for this job include: - Experience in .NET, Python, and JavaScript - Experience with Web API and SQL server - Familiarity with Power Apps, Power Automate, and Power BI - Experience in Azure, DevOps, and CRM D365 As someone with over eight years of experience in software development, I expect high-quality output. I am particularly interested in those who can demonstrate robust experience in these areas, so please include your past work and detailed project proposals. This will aid me in making an informed decision in my selection process. I am looking forward to engaging with a dedicated, well-versed team for long-term collaboration.

    €22 (Avg Bid)
    €22 Oferta mesatare
    18 ofertat

    I'm in need of an experienced Figma designer who can create a clean and minimalist design for my social media platform. This platform aims to engage millennials, business professionals as well as creative professionals. Key Design Points: - Emphasize on user profiles, post creation, and interactive forums. - The design should reflect a modern touch while maintaining an easy and fluid user experience. Ideal Skills: - In-depth experience with Figma - Ability to design sleek and user-friendly social media platforms - Strong understanding of current social media trends - Prior experience creating designs targeted at millennials, business, and creative professionals.

    €246 (Avg Bid)
    €246 Oferta mesatare
    59 ofertat

    Hi ART LAND DESIGN, I noticed your profile and worked together before . Can we chat about a simple project please ?

    €232 (Avg Bid)
    €232 Oferta mesatare
    1 ofertat

    ...will primarily deal with digital products and various services. Noteworthy components that should be integrated include: - A robust payment gateway: This website must allow customers to confidently and securely make purchases. Vendors should be able to easily receive their payments. - Variety of payment options: The successful implementation of diverse payment methods including Credit Card and Paypal is a must. The ideal freelancer for this project should possess: - Extensive experience in developing ecommerce websites. - Previous work on multivendor platforms. - Proficiency in integrating various payment gateways. - A solid understanding of handling digital products and services on a website. In your bid, please include relevant samples of your past multi-vendor website dev...

    €161 (Avg Bid)
    €161 Oferta mesatare
    23 ofertat

    More details: What is your objective in logging into the Income Tax website through Selenium and Google Chrome? Automate tax return filing What details will need to be automated during the tax return filing process? Only Login to Website What are the specific steps involved in the login process to the Income Tax website? Enter username and password

    €53 (Avg Bid)
    €53 Oferta mesatare
    5 ofertat
    Multifaceted E-Commerce Site Build 6 ditë left
    VERIFIKUAR

    Outstanding ...different categories such as plush, electronics, apparel, and custom items. The platform should be able to handle multiple modes of payment including credit card, PayPal, and bank transfer. The platform should host a gallery and allow appointment booking and application download. Application is copyrighted, patented and in design. Skills and experience required: - Proven experience in e-commerce website development - Exceptional understanding of various payment gateway integration - Excellent knowledge in various product categorisation - Strong attention to detail - Understands requirements for a multi-category e-commerce site The aim is to create a comprehensive, user-friendly and secure platform that supports a diverse array of products and multiple payme...

    €17 / hr (Avg Bid)
    €17 / hr Oferta mesatare
    216 ofertat

    I am looking for an experienced Wix specialist to improve both the loading speed and overall performance of my small-traffic website, handling up to 500 visitors per day. Key Responsibilities: - Evaluate current performance of the website - Identify factors slowing down website load times - Implement solutions to improve both the loading speed and overall performance Skills and Experience Needed: - Proven experience optimizing Wix websites - In-depth knowledge of performance metrics - Successful track record of improving website speed and performance Please provide examples of past work demonstrating your experience and success in this area. Ultimately, I am keen to provide an optimal user experience for my website visitors, so your ability to notable improvements is key.

    €112 (Avg Bid)
    €112 Oferta mesatare
    147 ofertat

    ...alternative options. Most likely, in the future, we will move towards a more specialized solution. We consider the project as an example of what we aim to achieve. Requirements: - Development of standard web application functionality, including a database for storing dialogues and user information, authentication, payment systems (Stripe, PayPal, etc.), catalog search, email notifications, and logging. - The site should be well-indexed by search engines and meet other standard SEO optimization requirements. - We accept the use of ready-made templates, modules, and plugins, as well as No/Low-code platforms (for example, , ) to reduce workload and speed up production. Future Plans: After the successful completion of the basic version

    €23 / hr (Avg Bid)
    €23 / hr Oferta mesatare
    89 ofertat

    I seek a passionate website designer who can add a refreshing splash of color to both the header and footer of my Shopify website. The ideal freelancer should have: - Expertise in Shopify customization - Vast experience in color theory - Proficiency in UX/UI design Tasks will include: - Implementing a complimentary (two colors) color scheme to my site's header. - Applying a similar complimentary color scheme to the site's footer for consistency. The goal here is to make my website more appealing and engaging for visitors by incorporating strategic color aesthetics. Your artistic insight and suggestions are also welcome.

    €72 (Avg Bid)
    €72 Oferta mesatare
    208 ofertat
    Need some work on an existing site 6 ditë left
    VERIFIKUAR

    More details: What specific changes or improvements would you like to see on your existing site? Redesigning the layout, Adding new features/functionality What kind of new features or functionality do you want to add to your website? For Body shop site What specific features do you want in the e-commerce capabilities for your body shop website? It's a kind of informatory site having a data of automobile shop

    €253 (Avg Bid)
    €253 Oferta mesatare
    84 ofertat

    I need Intergrat auto Payment by Crypto and Papal to my website​ -Top up Page 1-Paypal,​ Crypto Trc20 - Usdt (Auto & Manual) *All Recharge will send alert Notification to Admin dashboard My website

    €44 (Avg Bid)
    €44 Oferta mesatare
    53 ofertat

    As a business looking to create a substantial presence online, I'm looking for a talented web developer to mastermind an e-commerce website from the ground up. Your expertise should include, but not be limited to: * Full stack development of an e-commerce site * Ability to integrate key functionalities such as user registration/login, search capabilities, and online payment options While I realize these expectations are high, I trust that your portfolio will reflect your competence in these areas. I look forward to collaborating with a dynamic, punctual, and results-oriented individual or team that has a track record of stellar web development projects. I am looking for websites development My project is the Beauty parlour websites,there will be booking system, services like...

    €61 (Avg Bid)
    €61 Oferta mesatare
    38 ofertat

    I'm in urgent need of assistance to convert my project into VB .NET. I'm seeking a freelancer with: - Significant experience with Visual Studio .NET. - Expertise in project creation, debugging, troubleshooting and implementation of database connectivity. - Proven ability to work quickly and effectively, as this project needs to be completed ASAP. Please note, the application type was not specified - further project details will be provided upon project commencement. Your broad range of experience will prove invaluable in this role.

    €6 - €48
    I vulosur
    €6 - €48
    20 ofertat

    I'm on the lookout for an experienced developer to create a novel concept: a fantasy sports website focused around the Stock Markets. Here are some of the things you'll be responsible for: - Designing a user-friendly interface for user registration and profile creation. - Implementing drafting and team management features. - Building in real-time scoring and statistical tracking. - Implementing a secure and reliable payment gateway. - Crafting a system to manage various contests. While this project is in its nascent stages, I expect fewer than 1000 user registrations to start, so scalability will be important moving forward. Prior experience with fantasy sports websites or financial market websites would be a significant advantage. I'm looking for someone who can bring t...

    €215 (Avg Bid)
    €215 Oferta mesatare
    27 ofertat

    I am looking for an adept WordPress developer to create an engaging website to showcase my business's mission and vision. This site is significantly targeted towards professionals in a specific field. The core feature entails: - Displaying refined content about the company's mission and vision. Ideal freelancers should possess: - Proven experience in WordPress website development. - A robust understanding of creating business-oriented websites. - Demonstrated capability in crafting sites intended for professionals in a particular field. Your insight into SEO best practices and WordPress themes beneficial for businesses would be highly valued. Gets additionally valued for having a keen eye for detail and the creativity to make a website stand out.

    €102 (Avg Bid)
    €102 Oferta mesatare
    81 ofertat

    ...recommendations and implementation of improvements to my website to help increase sales. - You will first analyze the existing SEO performance and indicate areas that need improvement; - You will then make changes focusing on keyword optimization and technical SEO to drive more organic traffic; - As my site is built on the CS-Cart platform, I require someone experienced in working with this specific CMS for a seamless working process; - On top of your SEO duties, you will make recommendations for site improvements and upon approval, implement them; - By the end of the project, I expect to have a more visible, efficient, and user-friendly website. Ideal candidates should have solid experience in SEO (especially keyword optimization and technical SEO), proficiency with C...

    €15 / hr (Avg Bid)
    €15 / hr Oferta mesatare
    174 ofertat
    Trophy icon CREATE AN ONLINE STORE ON SHOPIFY 13 ditë left

    SELLING OVER 100 PHYSICAL PRODUCTS ONLINE THROUGH SHOPIFY. WITH THE ABILITY TO PROCESS CREDIT/DEBIT PAYMENTS More details: What products or services will you be selling on your online store? Physical products, Digital products, Services How many products or services do you estimate to have in your online store? More than 100 What kind of payment systems do you want to be integrated int...PRODUCTS ONLINE THROUGH SHOPIFY. WITH THE ABILITY TO PROCESS CREDIT/DEBIT PAYMENTS More details: What products or services will you be selling on your online store? Physical products, Digital products, Services How many products or services do you estimate to have in your online store? More than 100 What kind of payment systems do you want to be integrated into your website? Credit card processing, ...

    €93 (Avg Bid)
    I garantuar
    €93
    32 kandidaturat

    I have a client that is looking to revamp his booking system as their previous vendor is no longer working on the product. Scope of work: - Select Date of booking - Able to select the different Futsal Pitch - Able to make payment - User login / logout flows - Data Migration from the existing system to new system. - Using an external DB like Supabase preferred and able to manage user on Wordpress Backend

    €750 (Avg Bid)
    €750 Oferta mesatare
    163 ofertat

    I need a seasoned Shopify developer to enhance my online store's functionality. The focus will be on ensuring smooth operations of the Shopping Cart & Checkout system, streamlining User Accounts & Profile Management, and integrating advanced Search & Filters. Additionally, adeptness in integrating payment gateways - specifically PayPal and Stripe, is required for seamless transactions. Ideal candidates should have a proven track record in creating efficient, user-friendly Shopify stores. Proficiency in e-commerce website development, advanced knowledge of Shopify platform and experience with popular payment gateways are key to this role.

    €6 / hr (Avg Bid)
    €6 / hr Oferta mesatare
    32 ofertat

    I am in search of a skilled WordPress developer for my website project. Key tasks will include: - Integrating e-commerce functionality: It's important for you to have experience in developing e-commerce platforms, with a comprehensive understanding of how to effectively set up and manage online inventory. - Incorporating PayPal as a payment gateway: Experience with PayPal integrations will be key here, as this will be our primary method of receiving online payments. - Implementing WooCommerce plugin: A knowledge of WooCommerce - from integration to configuration - would be required to meet the specific needs of my e-commerce website. Please bid only if you possess the aforementioned skills and experience. I look forward to working with you.

    €101 (Avg Bid)
    €101 Oferta mesatare
    71 ofertat