Assignment project design inplement windows desktop application vb net sql server meeting room database punët
responsible I am a lead frontend software engineer and for creating a mobile , web and desktop using different languages and technologies if u r interested just send me a message thank you and good luck applications
Pershendetje Glen. Jam e interesuar per ndihmen tuaj ne SQL. Do te me duhet ndihma jote ne nje provim neser. A mundeni te me ndihmoni me nje shume prej 10 euro per 1 or e gjysem?
Office 365, Wordpress server admin, closed server admin
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
mahdi mmahdi ta,dty kzgyshj dkgsigd hydgw sgjxfyhs
My project in detail sepse une jam nje bos i madh e venit o bab o bab hahahhahah
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
,,jkhkgjhcfxdtycfuvbinm', .':;lkljgkhjhfgjkl;'
dfdvvdevfceacvfvfev bhbjhbjhb jhjbhjhjvhjvjh jhvhjvjhv
java Assignment... ................c fvvfvf fcqfrcvlrkcv'fmvk'qviqernvoiqrjfoqrjv;oiqjv;oirejiornv;ejrvioerjv[oiarjvnlreuhnior[vjer;ivnfe;vinelvkjfnrv;aoi'evn[aeirfj[oqreihvnperu;gbhqr[eiovj[quv
android apksdnjasdsjcvsdb hjvbciasdc cs iudc bsbc iudvs scnsjkdhiosdjsc juhsjkchdjcfhbjdcsdbcvujdncjksdcbhsdhsdgc
android apksdnjasdsjcvsdb hjvbciasdc cs iudc bsbc iudvs scnsjkdhiosdjsc juhsjkchdjcfhbjdcsdbcvujdncjksdcbhsdhsdgc
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
i knoq adasfas fasfa fa fa jkjkjljfla
Vhjjhkbhjjffjkvhjjghkjghnnjjjhhhhhhhhhhhhhhhv
[test] slkdjlasdjalkd jldj ladkj ldjsadlkjd dj sldkjd a
Trabajar Jdkdidod Nsnddjdhdjdhdhdjshshshjsj
make a c applicatoionniwahdjksajk jksadbkjasbdkj bksajbdkjsabkjdb jaksbfkjasbkfjb kasjbfk bsakj bksjafbaksjbc
I'm in need of an experienced Linux programmer to update my current SMTP server code and add new routines. Key requirements: - Revise and improve the sending efficiency of the server - Add new functionalities to the existing code The ideal freelancer for this project should be well-versed in Linux programming and have a solid understanding of SMTP server architecture. Your proposal should include a detailed plan on how you aim to achieve the project requirements.
...a freelancer who can help me to test my web application for compatibility, bugs and user experience. Its a product manager where you can create the Categories and forms to input the information for any product/service. The application uses several user roles and each one has to be tested across all their functionalities. Key points: - I need the application to be tested on various browsers and operating systems. - It's important that the testing is thorough, ensuring that the application's functionality is consistent and reliable across different platforms. - Any issues that arise during testing should be documented clearly, allowing my development team to address them effectively. Ideal skills and experience: - Experience in web application t...
...an "Internal Server Error" on my Apache server and urgently require professional assistance to resolve it. Unfortunately, I do not have specific fixes in mind but it could potentially involve tasks such as updating the .htaccess file, modifying the Apache configuration file or adjusting permissions for my web directory. This job demands expertise in Apache server maintenance and problem-solving skills as it needs to be completed as soon as possible. Familiarity with best practices for handling server errors would also be ideal. This is the error: In the error log it states that the PHP script did not return a valid set of HTTP headers before the script finished execution. Upon checking the fpm logs I noticed the error, "[19-Apr-2024 06:18:36] ...
We need to customize linphone's windows/macOS/iOS/android apps with regular PBX features, sms,sip Presence,BLF,etc. Needs to be customize with our company logo/colors. Change colors and logos to match our theme. Sleek and professional design. Login screen to accept username and password or scan QR code Incoming and outgoing calls. Call Transfer (Blind and assisted transfer) Hold Call Transfer Call Attended Transfer Call End Call Conference Call (merge the calls) Video calls Presence and IM features Call history Smart contact list, with address book synchronization for smartphones Audio/video conference calls and scheduled meetings Call transfer and multi-call management (pause and resume) One-to-one and multi-participant conversations Intuitive mes...
I'm looking for a freelancer to assist me with data input tasks. The data to be inputted is sourced online, and it must be accurately and efficiently inputted into our system. Following data entry, the data will be used to update our database. Data Type: - Images - Text Requirements: - Min. 200 Full Described Entities per Week - Proficient in data input, especially sourcing from online databases - Skilled in database updating - Attention to detail to ensure data accuracy - Efficient and timely completion of tasks - Previous experience in similar roles would be beneficial
I am in need of a developer skilled in Python for a project concerning the creation of a tablet finder application compatible with Windows. The primary feature of this application must be search filters, specifically, those able to find tablets based on their MAC addresses. Ideal candidate would posses: - Proficient in Python - Experience in creating search filters - Familiar with MAC addresses - Working knowledge of Windows compatibility - Detail-oriented and able to work autonomously. The focus of this project is the development of a reliable application that can perform complex searches based on a tablet's MAC address. This is a specialized task requiring detailed and specific skill sets.
...in-depth Android application security assessment. Skills in the following areas are required: Static Application Analysis: Understanding of tools like PEView, Dependency Walker (for analyzing dependencies in a Windows environment), APKTool, Androguard, or similar. Dynamic Application Analysis: Experience with tools like Process Explorer/Monitor (for analyzing processes in a Windows environment), Wireshark, or comparable tools. Code Analysis & Reverse Engineering: Proficiency in Ghidra, SMALI/BAKSMALI, dex2jar, and similar disassemblers/decompilers for Android code. Key Requirements: Proficiency in Volatility, APKTool, and Ghidra Intermediate level of experience in Android application security assessment. Ideal Skills and Experience: Demo...
I’m seeking skilled machine learning experts capable of creating AI systems focused on preventing physical theft. The primary targets are retail stores, specifically, monitoring theft in aisles and the stock room. Ideal Skills/Experience: - Proficient in Machine Learning - Experience with AI security solutions - Background in retail security systems - Strong understanding of video surveillance tech Duties: - Devise advanced AI systems for theft detection - Prioritize monitoring of aisle and stockroom areas - Implement machine learning to enhance theft prevention - Ensure seamless integration with existing security infrastructure
I'm in need of a skilled developer who is proficient in a variety of programmin...critical issue with the registration process. Currently, upon successful registration, the user remains on the registration page. This is not the intended behavior, and I need a solution that will ensure that users are correctly redirected to their profile page post-registration. . This video helps what im trying to say. Ideal candidates for this project should have a strong command of HTML, JavaScript, CSS, PHP, and SQL. In addition, experience with Stripe payment integration and troubleshooting registration processes on websites is highly desirable. Please note that these two tasks are interdependent, and hence, need to be addressed simultaneously.
...process, including meeting all required deadlines * Communicate progress updates to management and incorporate feedback * Assist with post-award reporting and compliance as needed Requirements: * Proven track record of securing grants, preferably for startups or businesses in the jewelry or creative industries * Exceptional writing skills in English with impeccable grammar and attention to detail * Strong research skills and ability to quickly understand our business and funding needs * Excellent project management skills and ability to meet tight deadlines * Proficiency with common grant application formats and systems * Able to work and communicate effectively remotely Compensation: Freelance contract position compensated through a combination of a base fee per ...
Storecheckers are a Global Market Research and Mystery Shopping company. We undertake worldwide mystery shopping visits and audits. This assignment is an audit of an Examination Centre, checking that the security standards are being met. You MUST HAVE fluent English skills, and you must be able to communicate in a professional manner and be smart and well-presented, as you will be representing us during the audit. As an auditor, you will arrive at the test center an hour before the start of the exam, give your ID, show a letter of authorization, which we will provide for you beforehand, and tell them what you are there to do. You will then sit with the TCA or the manager and ask a series of questions, and ask to see various things. The audit itself is very simple and easy, as we ...
Storecheckers are a Global Market Research and Mystery Shopping company. We undertake worldwide mystery shopping visits and audits. This assignment is an audit of an Examination Centre, checking that the security standards are being met. You MUST HAVE fluent English skills, and you must be able to communicate in a professional manner and be smart and well-presented, as you will be representing us during the audit. As an auditor, you will arrive at the test center an hour before the start of the exam, give your ID, show a letter of authorization, which we will provide for you beforehand, and tell them what you are there to do. You will then sit with the TCA or the manager and ask a series of questions, and ask to see various things. The audit itself is very simple and easy, as we ...
Storecheckers are a Global Market Research and Mystery Shopping company. We undertake worldwide mystery shopping visits and audits. This assignment is an audit of an Examination Centre, checking that the security standards are being met. You MUST HAVE fluent English skills, and you must be able to communicate in a professional manner and be smart and well-presented, as you will be representing us during the audit. As an auditor, you will arrive at the test center an hour before the start of the exam, give your ID, show a letter of authorization, which we will provide for you beforehand, and tell them what you are there to do. You will then sit with the TCA or the manager and ask a series of questions, and ask to see various things. The audit itself is very simple and easy, as we ...
I'm currently experiencing a peculiar issue on my CentOS server. The process /usr/sbin/mariadbd is showing 109% CPU usage in the WHM task manager, although the server load is stable and I haven't made any recent changes. Your primary task would be to diagnose and resolve this problem. No error messages or warning signs have appeared, making the source of the issue somewhat inscrutable. Access will be provided via AnyDesk or a remote desktop connection for swift and efficient troubleshooting. Your expertise in the following areas would be invaluable: - Proficiency in CentOS server administration - Expertise in WHM and server task management - Experience in identifying and resolving high CPU usage issues - Strong communication skills to work...
I'm in need of a professional who can develop a desktop application that can generate addresses for my Solana token. Some key details about the project include: - The token will be built on the Solana blockchain, so experience with this platform is essential. - The desktop application needs to support multiple operating systems – Windows, macOS, and Linux. - The address generation feature should be seamless and reliable. I'm looking for a skilled developer who has experience in creating cryptocurrency-related applications, particularly on the Solana blockchain. The ideal candidate should have a good understanding of blockchain technology and be proficient in developing desktop applications for multiple operating systems. ...
I am currently facing an issue with my website - when a user registers on the site, instead of being redirected to their profile page ...redirected to their profile page or login page, the system keeps them on the same page. Furthermore, upon this failure to redirect, it shows it is successful when registering but doesn't take to another page. I need someone with strong proficiency in HTML, CSS, JavaScript, PHP, and SQL to diagnose the problem and implement a solution so that after successful registration, users are seamlessly taken to their profile page. The ideal candidate should have: - Significant experience in PHP, HTML, CSS, JavaScript, and SQL. - Proven track record in troubleshooting and rectifying website issues. - Firm understanding of user authentication a...
...dial a number through a VoIP service using the VCDial setup I have. The code should also play a pre-recorded message when the call is connected. The operating system I am using is Windows. Key Requirements: - Develop a Python script that can interact with the VCDial setup for dialing numbers. - Integrate the functionality to play a pre-recorded message once the call connects. - Ensure the script can run smoothly on a Windows environment. Ideal Freelancer: - Proficient in Python programming, with experience in telephony and VoIP setups. - Familiar with VCDial or similar systems. - Able to work effectively on Windows OS. - Prior experience in creating automated call systems or call centers would be a plus. My budget is not more than 5000-6000 INR for this. I can ...
I need a professional with extensive experience in Fuzzy Logic and Matlab. Since I haven't defined the exact task or domain, I anticipate your ability to tackle various applications ranging from control system design, pattern recognition, forecasting, robotics, financial analysis, to traffic control. The final output, yet to be specified, could be anything from improved system performance, enhanced decision-making, or better data analysis. Since the assignment specifics are yet to determined, I require someone who is flexible, creative, and solutions-oriented. Matlab proficiency is a must.
ONLY RE...for the current implementation are unknown as the previous question was skipped. In terms of hardware, my setup currently includes Windows and GPU. Thus, the successful freelancer should have experience working with these specifications and will consider this in the implementation process. The ideal freelancer should have an extensive background in Stratum v2 protocol, have efficient problem-solving skills, as well as have a competent understanding of mining software integration and optimization. Experience in working with Windows and GPU hardware is also a major plus. IN YOUR RESPONSE LEASE include - (1) how have you configured and set-up "tproxy in windows? (2) Have you used Awesome Miner? Have you used Minstrat? ONLY RESPONSES THAT ADDRESS THESE...
I am looking for a skilled professional who can help me compile OBS Studio from source with an old version of obs-browser (CEF version 75). This project is for personal use, so I'm not looking to distribute it to others. I need flash support, which works great with OBS version 24.0.3. But I'm looking to move to version 30.x for its WebRTC support and I need the old browser plugin. Old version of the plugin, available on GitHub '' is working on the latest v.30.1.2, but lacks support for browser audio. Key Requirements: - Compiling OBS Studio from source - Integrating an old version of obs-browser (CEF 75) Your Involvement: Since this is for personal use, I'm comfortable managing the setup process on my own. I am mainly looking for someone to help me with ...
Your task involves application of k-Means clustering in Orange data mining software with the aim to segment and profile the churners in Customer Churn file. By applying the k-Means clustering you need to explore how many types of churners exist and what characterizes those types. More specifically, this assignment consists of two tasks: Task a (Segmentation): Establish how many types of churners there are and the size of those types. This involves dividing the churners into segments. Task b (Profiling): Profile and appropriately name the identified types of churners based on the values of their shared characteristics, i.e. variables. Your submission ought to include: 1. Orange workflow1 containing the k-Means clustering analysis of segments and profiles. 2. Summary file ...
Application code to implement Roomio as a web application in python. You will use the table definition posted at the end of this document.
I am looking for assistance in optimizing battery performance through Matlab simulation. Due to the project specifics not being clarified, the professional should be comfortable and experienced in working with a range of battery types such as Lithium-ion, Lead-acid battery and Nickel-metal hydride batteries. Key points to consider for this project: Skills and Experience • Understanding and experience in working with various battery types • Proficiency in Matlab for creating simulations and testing • Strong analytical modeling skills Project Objectives • Provide research and suggestions on optimizing battery life, decreasing charging time and improving power output. • Develop a comprehensive Matlab model suitable for varie...
I am seeking a native German speaker to act as a virtual sales agent. The project involves - Promoting and selling a variety of services to a German-speaking audience - Operating on a virtual platform - Translation or localization of content may be necessary The ideal candidate will have a strong sales background, be fluent in German, and have room for flexibility in terms of services sold. Fields of work could include (but are not limited to) insurance, real estate or retail products. Proficiency in English would also be beneficial, but primarily, a strong command of German language is essential.
... All the tables are fed from the main large table (secondly rate table - real time table). Details about the models: ML Model Development: Anomaly Detection Model: Develop a model using Random Forest algorithms to detect unusual patterns in energy usage. SARIMA Forecasting Model: Implement SARIMA models to forecast daily energy requirements, considering seasonal variations. Database: A cloud SQL real time database is preferred. Front end: After analyzing the data, I want to display the results to the user in Flutter with a very simple UI. I want to display: - Total energy consumption. - A graph for the total energy consumption by hour. - Energy consumed for each device. - Energy consumption compared to yesterday's. - Estimated energy consumption by end of t...
I need a skilled PHP developer to create a few pages with a modern and interactive design. The web pages should incorporate functionalities like user registration and login, along with a contact form. This assignment requires a deep understanding of PHP along with a creative mind to ensure a user-friendly design that promotes interaction. Ideal Skills: - PHP development - Web design - Experience developing registration/login processes - Experience creating web-based contact forms
I need a talented VB.net developer with a strong background in SQL Server. Key Responsibilities: - Develop software applications using VB.net - Efficiently manage databases - Designing, coding, testing, and debugging software applications using VB.NET. - Calling third-party API - Payment gateway integration - Stored Procedure Ideal Candidate: - Proven experience in VB.net development - Strong familiarity with SQL Server - Good problem-solving skills - Ability to work independently and meet deadlines. Please provide relevant work samples in VB.net development and describe your experience with SQL Server.
