Attached xml sending request soap envelope vb net client ofbiz soap server punët
Office 365, Wordpress server admin, closed server admin
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
I am seeking a skilled web developer to create an website with a payment gateway for my...communication skills Website basics are: - Home page/About (this is just some text and image) - Steps/Process (just some text, description of service, icons) - Apply - ALL inclusive (this to include the payment gateway hook for Debit/Credit card/Bank Transfer). - This is form for client/customer to enter some basic details and for these to be stored in DB. First name, Surname, DOB, mobile, email, address. Need to create and store Account number assigned to client/customer. - Client Log IN (will need to send email confirmation/validation on initial signup). create username create 12 char password. Lower/Upper letters, numbers and 1 special char. m...
...public_html directory. Preceding the public_html (in the / directory), there are additional system files that are essential. I currently have 1 TB of data on the server, comprising images and other files. Up until now, I've been using FTP to manually upload code changes. However, I aim to transition to using GitHub, allowing me to leverage familiar code editors and enabling automatic updates to server files upon saving. However, the issue I'm encountering is that when attempting to update the server from GitHub, it scans for changes and potentially deletes files not present on GitHub. I don't want, for instance, the images stored on the server to be included in a separate defined folder on GitHub. Essentially, I only want the source code witho...
...designer to assist with the creation of a flyer, envelope, and card designs. The purpose of these designs is to enhance my branding and identity. Your task will include creating visually engaging and distinctive designs that align well with my brand image. Ideal Skills: • Experience in print design • Exceptional creativity and innovation • Proficiency in graphic design software • Precise attention to detail • Strong understanding of branding These designs will be essential in shaping a consistent and impressive brand identity. It is crucial for the designer to have a keen eye for designs that speak to the brand's essence and purpose. I need an A5 flyer portrait double sided with place holder to be used for different applications,also an enve...
I have a website which was developed over 2 years back and shelved halfway due to client not being interested. Back then the site was developed in node.js version 16. However version 16 is going to be deprecated this year and hence the website code needs to be updated to node.js version 18. My current host already has node.js version 18 with the website loaded, however website doesn't load and operate exactly as we need it. Its a simple site as it was shelved well before the work was completed. If you are able to do this effectively then the follow up project to complete this project will also be awarded to you.
I am in need of a seasoned professional for my database migration project. My existing database resides on SQL Server 2022 and I am aiming to migrate it to Oracle 19c. - The size of my SQL Server database is small, amounting to under 1 GB, but there are around 450 procedures and functions which have to be migrated - Experience with handling similar sized databases and an in-depth understanding of SQL Server 2022 and Oracle 19c is a must. - Proficiency in SQL and database migrations are critical, along with a problem-solving attitude. - The freelancer must ensure smooth transition with no data loss and optimal functionality post migration. - An established process, clear communication and deadline adherence are necessary. This is a challenging role requiring high expe...
I am looking for a skilled data scientist to make live predictions with existing ML modes. The models have been trained, with a couple of options to be explored. Task: 1.) I will provide a bigger dataset, modify the code to handle more (similar) data. 2.) Pick the best model (with highest accuracy) 3.) Apply the model to predict upcoming footba...accuracy) 3.) Apply the model to predict upcoming football matches (Unseen data) 4.) No 2 above requires preprocessing the new data to have same features as the train/test set, then apply () and model.predict_proba(). 5.) Put the results of the new predictions in a dataframe for further filtering. N/B: 1.) Read though and understand the request before contacting me. 2.) Budget is 10 - 20$ 3.) Timeline is 1 Day 4.) All files attached...
To manage hospitals and medical centers An integrated system for managing hospitals and medical centers, as it contains many features that help facilitate and organize work in terms of managing operations, reservations, and appointments. Additional features can be added to the system according to your needs Sending SMS messages Organizing the queue of visitors and printing the reservation numbers by the secretary A screen that displays reservation numbers, names of visitors, and notification of references to enter the doctor The possibility of attaching previous prescriptions or previous analysis results with references’ data by dragging an image or PDF file from the scanner. The possibility of attaching previous prescriptions or previous analysis results with reference...
...comprised of industry veterans, Confirmis business model is designed to overcome perennial lack of data (let alone quality data) to support effective decision making, particularly in developing economies. As a Site Verifier, you will be responsible for verifying a company’s existence through visual data by conducting a site visit to ensure that we provide reliable and accurate information to our client. JOB DESCRIPTION: • Market research, take pictures of the target address • Take pictures of the company, both outside and inside (with the company's permission) • Provide observation about the company's activeness • Make interview with the company representative if necessary REQUIREMENTS: • Must be living in (or nearby) Changwu Middle Ro...
I'm looking for a bustling, creative, and dynamic call-center to partner with for my sales activities. Here are the must-have requirements you will need to meet: - Language Proficiency: You must have agents who are fluent in German, Italian, French, Spanish, English and Dutch to cater to my extensive client base spreading across different regions. - Team Size: I require a dedicated team of 10-20 agents for this project to ensure ample coverage and maximise sales. - Focus on Sales: The sole objective of this project is to create and close sales. Therefore, your team should be skilled in all the stages of a sales funnel, from initiating leads to closing deals. This opportunity is not just about the fixed monthly income, but also huge commissions on every sale made. Ideally,...
I am urgently in need of a technician capable of setting up Sylius on our Linux server. The task needs to be expedited and experts with a proven track-record in similar projects will be ideally suited. Requirements: - Proficient in Sylius installation - Comprehensive understanding of Linux server operations - Ability to work quickly and meet deadlines The successful candidate will be well versed in managing servers with quick response times and high efficiency, particularly on a Windows platform. Please only bid if you can complete the project immediately.
I need a proficient developer to set up an ICE (STUN / TURN) server and a signaling server on my VPS. Key tasks include: - Enable real-time communication - Improve server performance - Enhance video call quality Features required: - Establish peer-to-peer connections - NAT traversal - Media relay Programming languages preferred: - Python - Java - Node.js Ideal candidate should have robust knowledge of real-time communication systems and good hands-on experience with server setup. Knowledge of network traversal using STUN/TURN server would be an add-on. In addition, familiarity with Python, Java, and Node.js is also highly desirable.
I need a reliable virtual assistant with stellar communication skills to coordinate discovery calls with potential clients. The goal of these calls is to build rapport, ...empathy towards the client's challenges, showing our willingness to help solve them. Key Responsibilities: - Email management: Arranging these discovery calls via email - Appointment scheduling: Setting up suitable times for these calls - Data entry: Logging data from interactions with potential clients. You should have: - Experience in Customer Service or a similar role - Solid understanding of client relationship building - Sound knowledge of appointment scheduling tools and data entry procedures This role is integral to understanding our potential clients' challenges and demonstrating how our serv...
Project Description: Video Editor for Courses and YouTube...Requirements: - Edit and enhance online courses and YouTube videos - Ensure videos are engaging, professional, and visually appealing - Trim, cut, and arrange video clips to create a cohesive narrative - Add special effects and animations to enhance video content - Optimize video quality, sound, and color grading - Implement text overlays, captions, and graphics as needed - Collaborate with the client to understand their vision and goals for each video Deliverables: - Edited videos for online courses and YouTube channel - High-quality videos with special effects and animations - Timely delivery of edited videos Please provide examples of previous work and demonstrate your expertise in video editing, special effects, and a...
...available in Bangalore) or over a video call (present outside Bangalore) that may take around one hour of your time. Please share your contact details or message me if you meet the following criteria. a) engaged in full-time freelancing based in India b) Working on medium to highly skilled (e.g., content writers, web developers, graphic designers, and IT consultants) gig assignments for more than one client c) Registered on over two gig work platforms (e.g., or freelancer.com). Overall, I require 25-30 respondents for the interviews. All the participants are eligible for an Amazon gift voucher of Rs. 500. The participation is entirely voluntary. If you have any questions or inquiries about the project, please do not hesitate to reach out! Thank you for your time, and I look for...
I am looking for a website which would allow a real estate agent/brokerage representing a seller to notify other real estate agents/brokerages what is the amount of compensation they or their client are offering to that real estate agent/broker for bringing a buyer who consummates a transaction on the property. This website needs to accommodate the address (including the country) as provided by the seller's agent/brokerage, and cross reference which MLS (Multiple Listing Service) the property is listed in, or none if an MLS for that territory does not exist. There needs to be fields for both "Buyer Agency Compensation" and "Non Agency Compensation". There needs to be a registration page for each broker to indicate their name; brokerage/company so this can...
We are a Brand Design ...Brand Design Company. We are looking for someone who can bring in clients from the Europe and across the US. The focus of this project is to generate leads from startup and small businesses. Utilizing a personalized approach to client acquisition, I'm looking for an experienced professional who can effectively put our goals into action. Ideally, the candidate will have: - Experience in B2B sales. - Proficiency in developing and implementing lead generation strategies. - An innovative approach to personal marketing techniques. Your objective will be to boost our client base and generate leads through personal marketing. Please include any previous relevant work experience in your proposal. Experience with startups or small businesses will be co...
I have a .XML file but I want this information in .SQL. So that means that it should be make fit for my website. I want a program that takes all the information and translates them to a .sql format
...existence through visual data by conducting a site visit to ensure that we provide reliable and accurate information to our client. JOB DESCRIPTION: • Conduct basic verification with the subject company’s authorized representative, such as line of business, key executives' name, etc. • Take pictures of the subject company and its vicinity, as per Confirmis’ standard operating guidelines. • Provide observation about the company to gauge activeness, e.g., staff working at the premise, loading/unloading of goods, etc. REQUIREMENTS: • Must be living in (or nearby) Sabha, Libya • Has a camera or phone/tablet of quality with a camera, internet access Please see the attached file for the site visit guideline. You are only requir...
...Design and development of client and freelancer user interfaces Management and editing of user profiles Ensuring job posting and application processes Implementation of security measures and protection of data privacy Requirements: Experience in front-end and back-end web development Knowledge of multi-user session management Experience in security measures and database management Preferably experience with similar projects Communication skills and problem-solving ability Additional Information: Project start date: Immediately Project duration: Flexible, to be discussed Location: Remote work Budget: To be discussed Application: To be a part of this project, please submit your CV and a summary of your experiences in similar projects. Additionally, we kindly request you to...
I need professional assistance in setting up a bulk email marketing campaign on Amazon SES. The primary purpose of this p...marketing campaign on Amazon SES. The primary purpose of this project is to send newsletters and updates to my existing list of subscribers. In essence: - You will integrate my current subscriber list into Amazon SES - You will design a system that allows for seamless sending of updates and newsletters. This task requires expertise in Amazon SES, Email Marketing, and perhaps HTML for email design. It's essential that all measures are implemented to ensure better deliverability rate and compliance with all Amazon SES email sending policies. Additionally, familiarity with email list segmentation is highly preferred to help organize the current list ...
I operate in the ...pertaining to these activities. You will need to be comfortable with: - Client Acquisition: This involves scouting and establishing new relationships with potential clients. - Product Demonstrations: You must be able to efficiently and persuasively show our clients our product range, explaining features and benefits on the spot. - Data recording and analysis: Accurate and consistent documentation and interpretation of sales data is essential to this role. This position requires you to travel consistently for client meetings, so willingness and ability to do so is a must. Ideal candidates are those with a strong background in retail sales and a proven track record in customer acquisition. Proficiency in data analysis tools and client presentation...
Remote Opportunity Job Description: Good knowledge of the product including BPM Fundamentals, Architecture Components, Techn...including BPM Fundamentals, Architecture Components, Technical Features such as Designer Features, Configurations in Appian etc. Should have hands-on experience in design and development in Appian BPM including components such as Tempo, Mobility Features, Forums, Discussions, Pages, Smart Services, Reports, Deployment etc. Should have good knowledge of Java, Angular JS, J2EE, Ajax, JavaScript, JS, XML, XSLT etc. Appian Certification L2. Should have handled teams of size 5-7 and should be able to mentor the team. Excellent analytical and communication skills. Required Skills: Java, Angular JS, React JS, Appian Apply only if you have good experience in abo...
...and connecting on kafka from external port 9093 or 9094 by hostname. Example client command: "kcat -b -L -J" I have already independently deployed a Minikube cluster with Strimzi and Traeffik, everything works fine inside the cluster, but to connect from the outside you need to connect via kafka :cluster-ip, and I can't do it. I know how to create self-signed certificates and a trusted certificate authority, so it shouldn't be difficult to quickly generate and and Key Responsibilities: - Configurate strimzi kafka :cluster-ip and tls:true - Configurate traefik kind: IngressRouteTCP - Configurate TLS self signed certificate for client and atach to strimzi truststore Ideal Candidate: - Expertise in working with
I'm seeking an experienced .Net developer who is skilled in ASP.Net, .Net Core and MVC. Your task will be to focus on web development. This includes certain functionalities such as making enhancements to the existing system and integration with a hardware device using APIs. Key Requirements: - Proficiency in ASP.Net and MVC - Able to work on enhancements for the current system - Proficient in hardware device integration using APIs The goal is to enhance the app and perfectly with our hardware device, improving the interfacing and general user experience. A good understanding and skills in web design and development is a must. Be ready for an adventurous and challenging venture!
...web developer who can create a robust, efficient, and professional-looking website for my spare parts business. The site needs to handle a massive quantity of parts from multiple brands. It will also serve as an inquiry platform for clients who want to request spare parts quotes. Ideal features for the website include: - A product search function that easily allows clients to find the spare parts they need. - A comprehensive parts catalog with categories and filters for effortless navigation. - A 'Request for Quote' form to facilitate client inquiries. The organization of products should be according to: - Brands that we carry. - Part types to provide ease in searching for specific components. The overall design and layout of the website should lean tow...
We are searching for a skilled XML developer to join our team for a data integration project. The ideal candidate should have in-depth expertise in XML technologies, including XML parsing, transformation, and schema design. Responsibilities will include developing XML-based solutions for data interchange, ensuring data integrity and compliance with industry standards. Proficiency in Java or other programming languages commonly used for XML processing is highly desirable. If you have a strong background in XML development and are interested in this opportunity, please contact us with your qualifications and availability.
Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.
...Employ data scraping techniques and prospect hunting methods to expand the lead database. Strategic Sales Approach: ● Develop and implement strategic lead generation plans to target key sectors and industries. ● Create effective sales presentations and pitches tailored to the needs of potential clients. ● Develop enterprise sales strategies to engage with large-scale clients and organizations. Client Relationship Management: ● Build and maintain strong relationships with leads and prospects through effective liaising. ● Nurture leads throughout the sales process, providing timely follow-ups and addressing any concerns or objections. ● Act as a trusted advisor to clients, understanding their business needs and offering tailored solutions. Sales Conversion: ● Convert sales prospect...
I'm on the hunt for an experienced ASP DOT NET storefront developer to solve a recent issue encountered with my clients website - from a product page enquiry form. Emails are not being received from the product page contact form. What I am looking for: • Expert knowledge and experience with ASP DOT NET • Proficiency in resolving email-related issues • Ability to work quickly and efficiently Your responsibility will be to fix the reason the emails are not being sent.. Your skills and experience will be central in restoring this essential part of our operation, so we can continue to effectively communicate with our customers.
... tranjaction history,delete and add account balance add,debit,notice 8. users oder informations 9. user invite members list 10. user bonus history data,login,time,ip addres,active time recive bouns bank informations list and update refrel link update option withdraw,approve,cancel,type region option (Agent option) red envelope report,recharge,withdraw trade,bonus (control option) result Green,red,violet,number, total amount green total amount red total amount violet total amount which number and control panel Auto result option low amount colour & low amount number and withdraw manage options all information update control panel *GAME PANNEL* ID
I am on the hunt for a talented freelancer who would work with me long term to edit and post TikTok videos on a daily basis for an educational/informational account. As the client, I will be handing over the content direction, so your main tasks would be: - Daily editing of a new TikTok video - Effectively adding text overlays - Skillful removal of pauses for a fluid and engaging video narrative - May need to experiment with different effects over time with me The video content will primarily be educational/informational, so an editor with a knack for communicating complex ideas in a concise and engaging way would be ideal. Also, in order to keep up with the pace of daily postings, time management and consistency are expected. Budget-wise, affordable services are a main priority....
... the application prompts the user to enter a password. The default password is set to "0000". Upon inputting this password, a secure connection is established between the Bluetooth device and the user's device. Full Device Access: Once the Bluetooth device is successfully paired, the user gains complete control over the device. This includes the ability to perform various operations, such as sending and receiving data or controlling device functionalities. ===================================================== I have an APK that fully interacts with a Bluetooth device, and I also have the decompiled source code. While the decompiled source isn’t perfect, it does allow me to access all the resources and Java classes. 1. Could you please create a complete A...
I urgently require a seasoned networking expert with a solid track record in securing clients in the North America sector. Your experience should include: * Active participation in industry conferences. * Constructive engagement in online networking forums. * Successful collaboration with professional organizations. Furthermore, your expertise should enable you to bring in clients interested in custom application development projects. Your knowledge of IT, combined with your networking abilities, should help me land high-value assignments. I look forward to witnessing how your professional networking skills can drive business growth.
I'm looking for a data ...for a data analyst who specializes in predictive modelling and trend forecasting using categorical data. Your main task is to efficiently analyze the text files (txt, json, xml) provided, to make predictions and forecasts. Key Responsibilities: - Analyze the provided categorical data coming in text format - Create predictive models - Identify future trends - Make forecasting based on the analyzed data Ideal Candidate: - Extensive experience in predictive modeling - Proficiency in analyzing categorical data - Has strong foresight to be able to make forecasts - Knowledge and experience in working with txt, json, and xml files - Strong attention to detail and accuracy With your help, I hope to make informed strategic decisions and create a fu...
I'm currently facing an issue with WooCommerce, where I'm not receiving any email confirmations or sending customer confirmation emails. This issue is not isolated to just email confirmations, I am unable to receive any other kind of emails from the WooCommerce store as well. It's important to note that this issue arose without any recent changes to my email or WooCommerce settings. I am looking for a freelancer with the following skills and experience: - Comprehensive understanding and experience with WooCommerce - Expert in diagnosing and fixing email delivery issues - Excellent track record in problem-solving and communication Here's the tasks I need you to handle: - Diagnose the current email issue - Implement a solution to ensure all WooCommerce emails a...
... - Actively seek out, identify, and address customer retention issues -Negotiating contracts and closing deals to meet sales targets Ideal Candidate Skills and Experience: - Proven B2B sales experience in the technology sector - Solid track record in customer retention strategies - Strong communication and negotiation skills Deliverables: -Weekly progress reports detailing leads generated, client interactions, and deals closed. -Regular communication with our team to coordinate efforts and ensure alignment. -Timely submission of proposals and contracts to prospective clients. Requirements: -Proven experience in sales, marketing, and networking, with a track record of success in acquiring new customers. -Strong communication and interpersonal skills, with the ability to buil...
I'm seeking an experienced .Net Core5 developer proficient in the Serenity framework to provide enhancements and development services in my current application. Here are the specifics: - Work on user authentication and authorization. - Undertake integration of databases. - Develop APIs. Existing Application Enhancement Requirements: - Reinforce the reporting and analytics module with data visualization features. - Optimizing workflow automation processes. - Development of additional new pages. Skill Requirement: - Proficient in .Net Core5 and the Serenity framework. - User authentication and authorization development. - Database integration. - API development. - Capability to enhance reporting and analytics with emphasis on data visualization. - Experience with ...
As the client for this project, I require an experienced professional who can design a nonlinear control system for a missile using Matlab/Simulink. Key Requirements: - Proficiency within Matlab/Simulink - Advanced understanding of nonlinear control systems - Proven experience in missile control This task specifically involves coding and simulation work in Matlab/Simulink to build a robust nonlinear control system that offers smooth and precise controls for a missile. Having prior experience in airborne vehicle control will be highly beneficial for this project. Time is of the essence and thus, a devoted individual who can adhere strictly to deadlines will be ideal for this project.
...fully functional E-commerce website dedicated to domain registration and web hosting services with Advanced Webhost Billing System Key Features: - Real-time domain availability checker, making registration effortless and efficient. - all this options are there with AWBS and need to add to html - User account area where customers can easily manage purchased services - Client area should access from AWBS System. This project requires an experienced web developer with a profound understanding of E-commerce websites and systems. The ideal candidate should have developed similar websites in the past and understand the intricate workings of domain availability checkers, automated billing systems, and user account areas. Previous experience with building platforms for
...visit to ensure that we provide reliable and accurate information to our client. JOB DESCRIPTION: • Conduct basic verification with the subject company’s authorized representative, such as line of business, key executives' names, etc. • Take pictures of the subject company and its vicinity, as per Confirmis’ standard operating guidelines. • Provide observation about the company to gauge activeness, e.g., staff working at the premise, loading/unloading of goods, etc. REQUIREMENTS: • Must be living in (or nearby) Sarihamzali mahallesi, Seyhan, ADANA, TURKEY • Has a camera or phone/tablet of quality with a camera, internet access • Must be available during business hours (9 AM - 4 PM) on working days Please see the attached fi...
...existence through visual data by conducting a site visit to ensure that we provide reliable and accurate information to our client. JOB DESCRIPTION: • Conduct basic verification with the subject company’s authorized representative, such as line of business, key executives' name, etc. • Take pictures of the subject company and its vicinity, as per Confirmis’ standard operating guidelines. • Provide observation about the company to gauge activeness, e.g., staff working at the premise, loading/unloading of goods, etc. REQUIREMENTS: • Must be living in (or nearby) Sabha, Libya • Has a camera or phone/tablet of quality with a camera, internet access Please see the attached file for the site visit guideline. You are only requir...
Project Objective: To create a composite image combining three elements: a POS system, a cash drawer, and a receipt printer, to be used as a design for a promotional postcard. Project Description: The project involves combining three Photoshop images into a single composition. The designer is required to position the POS system at the t...balanced spacing between elements. Refinement and Final Adjustments: Review the composition to ensure that all elements are aligned and proportioned properly. Make color, brightness, and contrast adjustments as necessary to achieve a cohesive appearance. Delivery of the Final Product: Export the image in high-resolution format, ensuring it meets printing requirements for a postcard. Provide the client with the final file ready for use in printed...
I need an experienced professional who can: - Configure the firewall rules on my windows server 2012 to allow external access. - Set up medium level security (balanced rules with a certain level of access). - Create special rules within the firewall for specific applications. If you've worked with IIS in windows server and can effectively configure the DNS record, you're an ideal candidate. Proficiency in managing protocols, ports, and applications within the firewall is highly desirable. Knowledge in VPN configuration and port forwarding could also be beneficial, though not specifically required for this project. Please confirm your familiarity with these specifics in your bid.
I'm looking for an experienced developer who can successfully integrate Autodesk ACC with through API. Tasks: - Retrieving documents from Autodesk ACC and sending them into bubble.io. - Sending files to a specified folder in Autodesk ACC. Key requirements: - Proficiency in using ’s API connector. - Experience in handling and transferring data and files between platforms. - Familiarity with Autodesk ACC's data handling. The documents need to be transferred to in their original format. This is a crucial aspect of the integration, therefore, attention to detail and accuracy in data transmission are of utmost importance. Expectations: - Use Autodesk ACC and to manipulate data. - Ensure seamless data synchronization. - Maintain the accuracy and integri...
I am looking for an interi...my living room. Let's make it a space where my cherished items can shine. Please check the sketch for details and dimensions. The shelves don't need to be aligned or from wall to the wall. I want something that looks nice and it's functional. There are two colours to be used as a combination(background/front doors etc..)- they are all named in the sketch provided. I have attached a picture of one white unit how the client likes it(please see shelves on the left side of the unit). I am also attaching a picture of a pullout shelve(for you to know what I mean) and one unit that we installed with desk(this is a sinilar project but without the panelling behind). The background can be in carbon grey colour or if you think it's to d...