Coding for calculator in vb punët

Filtër

Kërkimet e mia të fundit
Filtro sipas:
Buxheti
deri në
deri në
deri në
Lloji
Aftёsitё
Gjuhët
    Shteti i punës
    2,000 coding for calculator in vb punët e gjetura, me çmimin EUR
    qefqreqweqawdafsc Ka përfunduar left

    asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr

    €184 (Avg Bid)
    €184 Oferta mesatare
    1 ofertat
    yveguwvcjnjnecbkhb Ka përfunduar left

    ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif

    €105 (Avg Bid)
    €105 Oferta mesatare
    1 ofertat

    ...Skills: I'm seeking someone with a solid understanding of video creation, storytelling, and advertising. Prior experience in creating engaging social media content is advantageous. • Application Requests: When applying, please detail your experience in video development, especially relating to social media advertisement and promotion. Note: The desired video style was not specified, hence I'm open to your professional input whether it be animated, live-action, or mixed media. Please include this recommendation in your application. Let's collaborate and bring this script to life! The goal is for them to click into our link -

    €134 (Avg Bid)
    €134 Oferta mesatare
    44 ofertat

    ...me develop a multiplex server (mux) for the purpose of generating a DVB-T2 mux. The key functionality I'm seeking includes: - The ability to connect to multiple studios effectively to take in transmitted audio streams - These streams we're delivering are based on a MPEG-TS coding format, with an approximate bitrate of 80 kbit/s - The developed server needs to be capable of generating one approximately 50 Mbit/s DVB-T2 mux - I would also like the server to be compatible with DVB-C and DVB-S2 broadcast standards, as these will be deliverables from our source. Ideal skills for this project are a deep understanding of broadcasting servers, experiencing with MPEG-TS coding format, familiarity with DVB-T2, DVB-C and DVB-S2 broadcast standards, a...

    €117 (Avg Bid)
    €117 Oferta mesatare
    29 ofertat

    I am seeking assistance with a Python script. While there was no specific functionality specified, it would be great if the freelancer boasts a versatile skill set to handle different tasks that may involve: - Data parsing ...boasts a versatile skill set to handle different tasks that may involve: - Data parsing - Web scraping - File manipulation Due to the lack of a specified timeline, I'm somewhat flexible with the delivery date, but I'd appreciate consistent progress and updates. I am especially interested in working with individuals who have extensive experience in Python, but strong general coding knowledge is also useful in anticipating and troubleshooting issues. This open-ended project is perfect for someone who e...

    €106 (Avg Bid)
    €106 Oferta mesatare
    91 ofertat

    I am looking for a diligent and seasoned website developer to create a user-friendly website that primarily caters to member users. This website will hold a special focus on providing access to premium content reserved only for members. Key Features Required: - Inclusion of a member-specific login system in addition to the general user login functionality. - The member users, after logging in, should be able to effortlessly access the website's premium content. Premium Content: - The website will deal with services; these are the premium content that should only be accessible to member users. Ideal Skills & Experience: - Proven experience in creating user-specific login systems on websites. - Strong background in coding and webs...

    €435 (Avg Bid)
    €435 Oferta mesatare
    192 ofertat

    Hello, I'm looking for a developer with expertise in Solidity to build an NFT Staking Platform on the Ethereum Network. This is an exciting project requiring specific skills and experience. Key Requirements: * Proficiency in Solidity: It's important that you are confident and experienced in this coding language. * Past work: Be prepared to showcase your previous projects that relate to this one, it'll help to understand your experience and relevance to this project. Design Style: Despite skipping the design choice, I am open to suggestions regarding the design elements. I'm especially interested to see a combination of modern, minimalist, eye-catching, and clean aspects. I appreciate creativity and innovation, so please feel free...

    €1057 (Avg Bid)
    €1057 Oferta mesatare
    42 ofertat

    As the client, I'm looking for a proficient and dedicated freelancer to develop a Java open MPI program directed towards data distribution. This program should be designed primarily for Windows OS. Key Features: 1. Data Distribution: The application's main function should focus on data distribution. 2. Compatibility: It must be compatible only with Windows OS. Skills and Experience: - Strong competency in Java Open MPI programming. - Background in designing programs for data distribution. - Proven experience with Windows OS centered coding. The project timeline is urgent as I'm keen to have this application working ASAP. Your proposal would be much appreciated, especially if you have a strong grasp of Java, MPI frameworks, and a ...

    €21 (Avg Bid)
    €21 Oferta mesatare
    6 ofertat
    MS Teams Bot with Python & FastAPI 6 ditë left
    VERIFIKUAR

    As a client, I'm searching for an experienced developer who can create me an automated bot for Microsoft Teams Meetings. This bot should be capable of: Email Handling: - Generating a unique email address which will be used to handle MS Teams meetings invitations. Attendance & Meeting Management: - Auto joining and leaving meetings, based on the set schedule. - Accurately recording attendance of all participants. Recordings: - Recording all participants individually and the entire meeting, this includes both visual and audio content. Deployment & Coding: - The bot should be developed using Python and FastAPI. - It should be deployed as a microservice in a docker, with exposed APIs. - The bot should live store the meeting's files in r...

    €250 - €750
    I vulosur
    €250 - €750
    11 ofertat
    C programming project 6 ditë left
    VERIFIKUAR

    In this project you must implement the algorithm in code The primal dual simplex algorithm. At the theoretical level, below is the description of the algorithm: Given a linear programming problem And given a solution λ0 is applicable to the dual problem. Ideal Candidate Should Have: - Proven experience in application development - Proficiency in coding and debugging - programming C files.

    €113 (Avg Bid)
    €113 Oferta mesatare
    28 ofertat

    I am looking for experienced developers who can guide and potentially undertake the task of porting a 3D multiplayer game developed in Unity to the Nintendo Switch platform. Requirements: - Direct experience in game porting, especially Unity games to Nintendo Switch - In-depth understanding of platform restrictions and solutions for impactful porting - Capability to address any platform-specific features if found during the porting process What to Provide: Applicants should mainly provide proof of experience in the following: - Successful porting projects, especially to Nintendo Switch - Comprehensive understanding of game development in Unity (Ideally, you should provide info on the version of Unity you are comfortable with) - Familiarit...

    €136 (Avg Bid)
    €136 Oferta mesatare
    94 ofertat

    I'm looking for some help with software called Flypt Mover, which is for gaming motion simulators. If you are familiar with this software I need help with some basic coding to get everything working smoothly.

    €102 (Avg Bid)
    €102 Oferta mesatare
    81 ofertat

    I'm seeking an experienced electrical engineer to deliver a creatively designed, efficient electrical plan for the renovation of a commercial retail store in Los Angeles. Key tasks would encompass: - Transforming current lighting layout and design: Revamping the layout to a more modern, customer-friendly, and cost-efficient system. Ideal candidates should have a thorough understanding of retail space functionality, commercial electrical systems coding in Los Angeles. Experts in renovation projects are highly preferred. Project success will be gauged by the delivery of an effective lighting layout that creates an engaging retail environment while adhering to industry standards and local guidelines.

    €372 (Avg Bid)
    €372 Oferta mesatare
    53 ofertat
    User Activity Tracking Enhancement 6 ditë left
    VERIFIKUAR

    I am seeking expertise to refine my existing custom tracking code to gain better insight into visitor interest towards our products. The focus will be on monitoring the visitation of certain pages. Key Requirements: - Enhancement of existing custom tracking code - Experienced web analytics knowledge - Proficiency in visitor behavior analysis This job requires a firm understanding of user behavior online and a deep familiarity with custom coding for website analytics. Successful completion will depend on the improved tracking of user visits to specific pages. Desirable Experience: - Writing and improving custom tracking code - Visitor behavior analysis - Web analytics and performance optimization Note: same as the attachment

    €25 (Avg Bid)
    €25 Oferta mesatare
    69 ofertat

    I am in need of an expert to upload PHP to a Hostingger server, install a Domain Validation SSL, and ensure that my corporate website is functioning smoothly. Key Aspects: - Install PHP on Hostingger server - Implement Domain Validation SSL on the website - Optimize for a smooth run of a corporate website Aside from setting up the basics, I also require specialized security features for the PHP part of my website. You should have extensive experience in programming and security handling. Skills and Experience: - Proficiency in PHP coding and security customizations - Expertise in Operating Hostingger Server - Experience in Domain Validation SSL Installation - Knowledge on corporate websites dynamics

    €19 (Avg Bid)
    €19 Oferta mesatare
    22 ofertat

    ...Professional Website Development for Logistics Company Needed Description: We are a growing logistics company looking to establish a strong online presence with a professional website. We are seeking an experienced website developer who can create a dynamic and user-friendly website that effectively showcases our services and enhances our brand image. Key Requirements: 1. Professional Design: We need a modern and visually appealing website design that reflects the professionalism and reliability of our logistics services. 2. User-Friendly Interface: The website should be easy to navigate, with clear navigation menus and intuitive user experience to ensure visitors can easily find the information they need. 3. Comprehensive Service Pages: We require dedicated pages for...

    €108 (Avg Bid)
    €108 Oferta mesatare
    24 ofertat

    I need a focused developer well-versed in Python, Java, and C++ to build a Coding Problem IDE. The successful candidate will be able to construct a platform that should be able to function on CodeTikki.in. Key features of the IDE should include: - Code highlighting: This feature is necessary to make the code more readable and easily understandable. - Syntax checking: To ensure the code is error-free and runs smoothly. Expertise in IDE development, as well as proficiency in Python, Java, and C++, is essential for this project. Familiarity with and commitment to delivering a user-friendly interface is also important.

    €67 (Avg Bid)
    €67 Oferta mesatare
    12 ofertat
    Design & Build Real Estate Website 6 ditë left
    VERIFIKUAR

    ...with real estate website for my business. This person must have a strong background in creating websites, specifically within the real estate field. The capacity to diagnose and rectify issues quickly and competently is also desired. Though not explicitly listed, the website already includes the below functionality and it is your job to ensure everything is designed and set up to be a fully functional real estate listing and home rental website. The following are items that are set up and they just need to be customized to my requirements as I will give to you. - Property search functionality for all of Canada - Property listing display for both rental and homes for sale -Integrating google maps for all of canada -setting up pricing and page...

    €8 / hr (Avg Bid)
    €8 / hr Oferta mesatare
    74 ofertat

    ...seeking a proficient developer to build a software for a Bluetooth/LORA Gateway utilizing an ESP32 MCU to connect to sensor nodes. The functionality I envisage for this project includes: - Remote device management: The ability to manage connected devices remotely is crucial for this project. - Data logging: It is important for the system to be capable of accurately logging data from devices. Considering my preferences, the successful developer should have expert knowledge and experience with: - Arduino: Familiarity with Arduino's BLE/LORA is a requirement. You should have prior experience coding in Arduino / C++. [- Flutter: I've chosen Flutter as the platform for the software development. Correspondingly, knowledge of Flut...

    €436 (Avg Bid)
    €436 Oferta mesatare
    91 ofertat

    It is necessary solve some few errors that have my application. It is necessary experience in laravel coding. Please send me your experiences in complex coding not simple web). If you show me the experiences, I will send the details of changes

    €74 (Avg Bid)
    €74 Oferta mesatare
    139 ofertat

    I'm searching for an adept web designer to construct a dynamic, modern and minimalist lead generation website for the real estate industry. The website must contain certain key functionalities to streamline user interaction and gather valuable data: • Contact Form: There should be a user-friendly contact form on the website. This form should be capable of collecting a variety of details from potential leads - these include the user's name and email, their property interest and budget, and their contact number alongside the preferred time for a call. • Property Search Features: These are not required at present. • Mortgage Calculator: This functionality is not needed at the moment. The ideal candidate for this project would pos...

    €148 (Avg Bid)
    €148 Oferta mesatare
    221 ofertat

    I'm in need of a skilled JavaScript developer to help finalize the implementation of a rainwater calculator for a website. Here are the key specifics: - I've already done some coding but I'm struggling specifically with calling in data from files. - The files in question are JSON files. - The data from these files is crucial for the calculator's operations. The successful bidder should have strong proficiency in JavaScript, especially in the area of retrieving and manipulating data from JSON files. Any prior experience with building calculators or similar web tools will be positively regarded. Your task will be to help me not only implement this feature but also understand how it works.

    €25 (Avg Bid)
    €25 Oferta mesatare
    58 ofertat

    Hello, I am looking for some help with software called Flypt Mover, which is for gaming motion simulators. If you are familiar with this software I need help with some basic coding to get everything working smoothly.

    €11 / hr (Avg Bid)
    €11 / hr Oferta mesatare
    7 ofertat

    I am seeking a skilled web developer with experience in creating portfolio websites. Key Job Details: - You will be required to design and implement a portfolio website based on my needs. Ideal Skills: - Proficient in HTML, CSS, JavaScript and other relevant web design coding languages - Experience in creating aesthetically pleasing and functional portfolio sites - Excellent problem-solving skills - Strong communication and understanding of client's needs Please note, no e-commerce functionalities are required for this project. Let's discuss more about your past work, ideas for this project and your process.

    €269 (Avg Bid)
    €269 Oferta mesatare
    41 ofertat

    ...portfolio, blogging site, and more. Key Features: - Though no specific functionality was mentioned, being an all-rounded developer, you should be adept at creating features like a contact form, search bar, social media integration, and more. - Develop a responsive and user-friendly layout. Skills and Experience: - Past work and experience as a website developer are essential. Exceptional skills in coding and software architecture will be highly advantageous. - Strong understanding of website layout aesthetics and functionality. - Exceptional communication skills to ensure collaborative project progress. NOTE: Apply only if you can commit to the urgency of this job. Your detailed project proposal should include an estimated delivery time. Submissions without this will n...

    €9 / hr (Avg Bid)
    €9 / hr Oferta mesatare
    57 ofertat
    Python Web Scraper Debugging 6 ditë left
    VERIFIKUAR

    I'm in need of Python savvy individual who can quickly identify bugs and troubleshoot my current web scraping tool. The web scraper is designed to extract property descriptions from various real estate websites, however, it's currently not performing to par. If you are a wiz with Python and have experience with web scraping specifically: - You have an understanding of real estate jargon. - You possess proven Python coding skills. - You have a rich experience in data extraction and bug fixing. This task won't make you break a sweat. I need this done quickly and efficiently. If you feel you can tackle this, let's get the ball rolling.

    €25 (Avg Bid)
    €25 Oferta mesatare
    97 ofertat

    As an Arduino and Python developer, I'm looking for expertise to create a comprehensive flowchart that outlines the logic and working of an existing Arduino and python code. This is an essential task to me because I want to understand the sequential order of operations, from start to end. Main Focus: - Emphasizing the relationship of different features coded, and their flow from start to completion. - As one knows, the different parts of the Arduino code work together in achieving specific output, hence, a skilled understanding of the code's hierarchy is of great relevance. Ideal candidate: - Proficiency in Arduino and Python language. - Strong experience in flowchart development. - Ability to analyze complex scripts and map process flows. - Detail-...

    €16 (Avg Bid)
    €16 Oferta mesatare
    43 ofertat

    Engaging a dedicated and experienced freelancer to partner with me in the exciting "Image Matching Challenge 2024 – Hexathlon challenges" by Kaggle. YOUR ROLE: - You'll be contributing your Machine Learning expertise for the coding and deployment of the models. MY ROLE: - As for me, I'll cover the other areas of the project aligning with my skills. REQUIREMENTS & EXPERIENCE: - Have previously participated in Kaggle challenges - Strong expertise in Machine Learning - Ability to work well as a part of a team This is a great opportunity to exercise your Machine Learning skills and contribute to challenging Kaggle competitions. Let's tackle this challenge together! No budget for this challenge, wanted t...

    €85 (Avg Bid)
    €85 Oferta mesatare
    7 ofertat

    ...app and website. Our aim is to provide users with a seamless and intuitive platform for searching, exploring, and interacting with properties. Below are the key features we envision for both the website and mobile app: **Website ?:** 1. **User-friendly Interface:** Design an intuitive and easy-to-navigate website layout. 2. **Advanced Search Filters:** Implement robust search filters for precise property searches. 3. **Property Listings:** Display detailed property listings with descriptions, images, virtual tours, and floor plans. 4. **Interactive Maps:** Integrate interactive maps for visual property location representation. 5. **Saved Searches and Alerts:** Allow users to save searches and set up alerts for new listings. 6. **User Accounts:** Provi...

    €1474 (Avg Bid)
    €1474 Oferta mesatare
    84 ofertat

    I am seeking ...seeking a skilled web developer with experience in Stripe payment integration for an e-commerce website. The ideal candidate should be familiar with web design standards, coding and user experience considerations, tailored for an e-commerce environment. The main components of the project will include: - Designing and establishing an e-commerce website. - Integrating Stripe as the payment gateway. Desired Skills: - Mastery of web development - Experience with e-commerce websites - Proficient in Stripe payment integration - Knowledge of multiple currency handling (preferable) The project doesn't necessarily require support for multiple currencies at the moment, but any experience or familiarity with multi-currency on Stripe...

    €6 - €60
    I vulosur
    €6 - €60
    60 ofertat

    We are looking for working professionals who are looking to mentor coding one-on-one over the weekends and make some side income. Requirements: 1. Be really good at DSA 2. A good ability to mentorship 3. Great communication skills 4. Working at a high growth startup or a reputed company You can set your own hourly rate and get paid for teaching your skill to students and helping them out in their careers.

    €9 / hr (Avg Bid)
    €9 / hr Oferta mesatare
    9 ofertat

    I am working on some electronic project and I am using voltage sensor current ,ultrasonic,screen ,tower light MOSFET module Arduino and need coding for the project

    €16 (Avg Bid)
    €16 Oferta mesatare
    11 ofertat

    I'm in need of a dynamic, intuitive Online Education Market Platform. This platform will serve a diverse user base that includes students, teachers, and educational institutions. Key Features Required: 1. Diverse User Capability: The platform must accommodate students, teachers, and institutions. This means tailoring functionalities to meet each user type's unique needs. 2. For Institutions: The platform should enable institutions to post various types of courses, communicate with students, , track performance , recruiting of students , making online payment , revenue sharing with the platform owner etc . 3. Types of Courses: The platform should support the offering of academic courses, professional development courses, and skill-based courses. Ideal Skills a...

    €343 (Avg Bid)
    €343 Oferta mesatare
    244 ofertat

    I am in need of an experienced coder who specializes in PineScript and ThinkScript. The project requires: - Coding for both TradingView and Thinkorswim platforms. - Implementing a trading automation system. - Using a specific trading strategy, namely Moving Average Crossover. Given these requirements, the ideal candidate should have: - Proven experience in PineScript and ThinkScript. - Familiarity with TradingView and Thinkorswim platforms. - Knowledge and understanding of the Moving Average Crossover trading strategy. - Previous projects involving trading automation implementation. Your task will be to develop and implement a script that accurately employs the Moving Average Crossover strategy and automates trading on both platforms. Please include r...

    €26 / hr (Avg Bid)
    €26 / hr Oferta mesatare
    54 ofertat

    I need a professional with experience in Shopify custom liquid coding. The objective of this project is to create three custom liquid codes based on samples I will provide. With this, my website's performance will improve. Ideal Skills: - Proficiency in Shopify platform - Expertise in custom liquid coding - Understanding of front-end development - Ability to execute based on samples Applicants should include a detailed description of their past experiences in creating custom liquid codes, specifically for Shopify. This will give me insight into your ability to successfully complete this project.

    €32 (Avg Bid)
    €32 Oferta mesatare
    64 ofertat

    I am seeking a skilled iOS app developer to transform my Google Sheets Solar PV calcul...user-friendly platform where users can input data and achieve automatic calculations. Key app functionality should include: - User interface for data input - Calculation output based on the user input, specifically for matching arrays to inverters Key skills and attributes required: - Proficiency in iOS app development - Understanding of Solar PV systems and calculations - Experience in creating apps with calculation functionality - Ability to adhere to project deadlines and deliver a fully functional application. Note: There are no requirements for data storage, third-party app integrations, or push notifications for this project. However, a keen eye for...

    €348 (Avg Bid)
    €348 Oferta mesatare
    68 ofertat

    I am in need of a professional web developer to build a minimalistic website using custom HTML or any other softwares, as it holds a unique flexibility that specific templates can't provide. I have a registered domain name ready to deploy once the website development is completed. The ideal candidate for this project should have: - Expertise in custom HTML coding - Strong design skills to create a clean, minimalistic look - Experience in domain connection Your responsibility will be to create a visually appealing, user-friendly layout in line with my design preference, as well as to execute the website and domain connection. If you have a solid understanding of how to link the website to my existing domain without disruption, and have a kn...

    €34 (Avg Bid)
    €34 Oferta mesatare
    47 ofertat

    ...display system onto an aftermarket LCD screen. Key expectations for the project include: - Configuring the screen to display necessary live data from the Flipper Zero - Producing a high-resolution display that is clear to read - Implementing a control system to adjust the screen's backlight The ideal programmer would have: - Demonstrated experience in coding for aftermarket LCD screens - Comprehensive understanding of Flipper Zero systems - Proficiency in ensuring the readability and functionality of LCD display output. I would appreciate if the task could be accomplished within a month's time. The goal is to have an aftermarket LCD screen that looks and behaves like the original, displaying all necessary information for effecti...

    €101 (Avg Bid)
    €101 Oferta mesatare
    25 ofertat

    ...seeking a competent Adobe Animate artist and coder with experience in creating interactive prototypes. The project will simulate a desktop environment where the user will follow a linear path or steps in order such performing a web search, scrolling through results and clicking on a predetermined link to bring up a search page. All graphic elements will be provided by us as vector layers for you to make interactive within the prototype desktop environment. Key points to note about the project: 1. **Level of Interactivity**: The outline project needs advanced interactivity. This includes but is not limited to the development of simulated desktop environments. 2. **Graphic Elements**: The graphic elements that will be deployed in this project are majorly V...

    €865 (Avg Bid)
    €865 Oferta mesatare
    44 ofertat

    The objective for this project is to develop a conversation code written in C#. As a developer, I need a proficient freelance coder who has significant experience in C#. Upon completion, the code should be sent over as a file attachment. Key Skills Required: - C# coding expertise - Encryption Decryption expertise - Ability to develop interactive conversation codes - Accurate and efficient coding - Understanding of effective file attachment methods I just want console app that decrypt the provided payload in the ruby code, after you done, I will send some test data to make sure it I working correctly. Below code is written in Ruby I need same in C# see attached file

    €111 (Avg Bid)
    €111 Oferta mesatare
    39 ofertat
    Trophy icon Dynamic Fillable Form Creation 6 ditë left

    I'm in need of a seasoned professional to create a dynamic, easily fillable form in either Word or Excel. This form needs to be highly versatile, accommodating various input types and behaviors. Key features desired include: - Conditional color changes based on text inputs, selections from dropdowns, and checkbox checks. - Seamless conversion to PDF once filled out by our team. Expertise in creating dynamic, interactive forms and firm understanding of input condition coding are essential in order to be successful in this project. I need this project completed as soon as possible, so proficiency under tight deadlines is another critical skill. Attached is the template form for your reference. The template I attached was designed by o...

    €46 (Avg Bid)
    I garantuar I vulosur
    €46
    11 kandidaturat

    I'm in urgent need of assistance to convert my project into VB .NET. I'm seeking a freelancer with: - Significant experience with Visual Studio .NET. - Expertise in project creation, debugging, troubleshooting and implementation of database connectivity. - Proven ability to work quickly and effectively, as this project needs to be completed ASAP. Please note, the application type was not specified - further project details will be provided upon project commencement. Your broad range of experience will prove invaluable in this role.

    €6 - €48
    I vulosur
    €6 - €48
    21 ofertat

    I need an experienced Pine script coder for developing my EMA (Exponential Moving Average) strategy on TradingView. The key task is to incorporate - Implementing and coding the EMA strategy I've detailed. - Ensuring the script can backtest trading data effectively. - Coding the script to generate trade signals. Furthermore, I want this script to automatically initiate and execute trades Synchronized with my broker account. This calls for a high-level experience in TradingView API and order management system. Additionally, this project requires backtesting the strategy on a mixed dataset of both specific historical and most recent market data for determining the effectiveness of the automated trading strategy. Proven expertise in back...

    €91 (Avg Bid)
    €91 Oferta mesatare
    12 ofertat

    Minimal lines o.../main/lib/matplotlib/ Py to c++ job. Radio unit exposure a plus. Battery knowkedge plus. --- I am in need of a specialist in C++ programming to create a library with a C-wrapper. The primary aim of this undertaking is data visualization, plotting graphs, and crafting charts. Key requirements are: - Exemplary C++ coding skills - Experience in handling inputs/outputs - Expertise in file manipulation - Knowledge in the creation of C-wrappers Your task will be to develop a C++ library that includes a C-wrapper, enabling top-notch file handling for data visualization. Please note that the work doesn't involve creating a C-wrapper for an existing library, but rather coding a new one from scratch. Only tho...

    €25 / hr (Avg Bid)
    €25 / hr Oferta mesatare
    65 ofertat
    Experienced React Developer Needed 5 ditë left
    VERIFIKUAR

    ...expanding business, we are in need of an experienced and proficient React developer who can help push forward our growth. We are unable to specify the exact features we're expecting the application to have at this moment, but we're looking for an individual who is able to adapt to our changing requirements along the way. Key Job Duties: - Willingness to engage in the development process of a flexible React application that may include features such as user authentication, CRUD operations, and real-time updates in the future. - Collaboration and communication with our in-house team for clear and efficient project progression. Required Skills and Experience: - Extensive experience as a React developer - Proficiency in functional...

    €110 (Avg Bid)
    €110 Oferta mesatare
    55 ofertat

    ...functional, high-quality theme for sale on various theme marketplaces. Our design has been meticulously crafted, and we require an expert to bring it to life, ensuring it is both visually appealing and technically sound. Responsibilities: • Convert provided UI/UX designs into a fully responsive theme. • Ensure the theme is compatible with major browsers and devices. • Implement SEO-friendly coding practices. • Optimize the theme for speed and efficiency. • Incorporate best practices for user experience and accessibility. • Prepare the theme for easy customization and integration with popular CMS platforms (e.g., WordPress, Shopify, etc.), if applicable. • Provide documentation for theme installation an...

    €132 (Avg Bid)
    €132 Oferta mesatare
    187 ofertat

    I have web flutter language code. I need : WordPress work knownlage Updates some pages Add Amazon affiliate code ( I have account and links) I want fix some thinks And I want update my web domain Everything is ready Must have experience at Firebase database Flutter language coding WordPress work

    €15 (Avg Bid)
    €15 Oferta mesatare
    26 ofertat

    I'm seeking a jack-of-all-trades in design and tech; someone with vast capabilities in graphic and UI/UX design, as well as game design for iOS platforms. The scope extends to drone and Raspberry Pi projects, in addition to web design. Your proficiency in embedded systems programming, web development, mobile app development, Arduino, and video game design will be crucial. Understanding a beginner's perspective will be key, as the project requires design and coding deliverables easy for beginners to grasp and use. Key Skills & Experience: - Graphic, UI/UX, Web and iOS game design - Coding prowess in Web & Mobile app development - Proficient with Raspberry Pi, Arduino and Drones - Game Design and Development -...

    €19 / hr (Avg Bid)
    €19 / hr Oferta mesatare
    88 ofertat