Create order details page asp net vb sql punët
Pershendetje, puna eshte shume e thjeshte. Duhet te beni Like 30 postimet e fundit ne faqen tone te Instagram dhe Facebook nga 20 profile REALE Ju lutem na shkruani per cdo pyetje dhe nese bashkepunimi eshte i kenaqshem do kemi pune te tjera per ju.
Pershendetje Glen. Jam e interesuar per ndihmen tuaj ne SQL. Do te me duhet ndihma jote ne nje provim neser. A mundeni te me ndihmoni me nje shume prej 10 euro per 1 or e gjysem?
ping me
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
Stranica za uredivanje slika i stranica
test porject test porject test porject test porject test porject test porject test porject test porject test porject
hasgdhskcbkjbckjbxkjcbsjdkckjdckjdbskjcjsdckjbncvsahgckhasvhchjsagchashcajsvcjhsajhcasjhcvsjchasbhcjsagcs
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
...filter settings, but they can't make any changes and can't see any other modules at all, what they can do is just view NSC module, use the search, filter, or print(if available) features, also, please instruct us how to create this specific users. - Co-ordinator in project/Task can also edit the project/task/so/sales/quotation / purchase order and all custom modules we created - Additional five Project list reports, just use the existing one and change the fields, add one combine report and one button or dropdown list then generate that. - Task, one click to update or add, create buttons in the task, then each button can copy the certain fields data from project to the certain fields in task? For example, click button one can copy project name and dates fi...
I require a knowledgeable freelancer to build an Excel sales order form which can handle multiple ship dates and calculate discounts on a sliding scale. Key Functionalities: - Multiple ship dates: I would like customers to choose their ship dates from a calendar function. - Discount calculation: Discounts should be calculated on a sliding scale based on the volume of the order. The ideal person for this task will have proven experience in building advanced Excel spreadsheets, primarily focusing on dates manipulation and financial calculations. An understanding of sales processes, specifically as it relates to ship dates and discounts, is advantageous.
...on stripe showing the products. - Registration Redirection Fix: The second task is addressing a critical issue with the registration process. Currently, upon successful registration, the user remains on the registration page. This is not the intended behavior, and I need a solution that will ensure that users are correctly redirected to their profile page post-registration. . This video helps what im trying to say. Ideal candidates for this project should have a strong command of HTML, JavaScript, CSS, PHP, and SQL. In addition, experience with Stripe payment integration and troubleshooting registration processes on websites is highly desirable. Please note that these two tasks are interdependent, and hence, need to be addressed
I am currently facing an issue with my website - when a user registers on the site, instead of being redirected to their profile page or login page, the system keeps them on the same page. Furthermore, upon this failure to redirect, it shows it is successful when registering but doesn't take to another page. I need someone with strong proficiency in HTML, CSS, JavaScript, PHP, and SQL to diagnose the problem and implement a solution so that after successful registration, users are seamlessly taken to their profile page. The ideal candidate should have: - Significant experience in PHP, HTML, CSS, JavaScript, and SQL. - Proven track record in troubleshooting and rectifying website issues. - Firm understanding of user authentication an...
Create Engaging YouTube Ai Video upto 4 minute
...customers to check if their location falls within the service area. - Online Appointment Scheduling: Implement an intuitive appointment scheduling system that enables customers to book service appointments directly from the website, specifying their preferred date, time, and service required. - Quote Request Form: Provide a user-friendly quote request form where customers can submit their project details and receive personalized quotes from Domino Home Services. - Customer Testimonials and Reviews: Feature a dedicated section showcasing customer testimonials and reviews, highlighting the company's quality of service and customer satisfaction. - Service Area Map: Incorporate an interactive map that visually represents the service areas covered, allowing customers to quick...
I want a comprehensive application that offers various home services by paying a membership. These include household cleaning, pet walking, carpentry, plumbing, electrician servi...2. Experience creating service marketplace apps 3. Strong skills in location-based features and real-time scheduling The app should have real-time chat and email functionality for user-professional interaction. Therefore, a background in implementing such communication solutions will be preferred. This project requires: - User and service professional profiles - Option to list, explore, and order services - Real-time chat and email features - Secure online payments This is a challenging endeavor—but also a rewarding one. I look forward to connecting with talented freelancers who can bring this v...
I nees figma designer for 5 page website
...patterns and anomalies identified. Details about the data: I want to have 3 tables: Real time data table: The data will be captured directly from sensors at the form of columns, for example, Device 1, device 2 , device 3, and rows are time captured at growing rate of 1s. the value of the row is the energy consumed of that device at that exact second. This will be a large table. Hourly Data Table: Aggregate data hourly to feed into the anomaly detection model, stored in the 'Hourly' table, to identify significant deviations. Daily Data Table: Summarize daily data for use with the SARIMA model, aiding in long-term consumption predictions and trends analysis. All the tables are fed from the main large table (secondly rate table - real time table). Details about...
I screwed up on the backend of my we...backend of my website. The site is I must have clicked something that removed all the links to the socials on the sign up page. I need for someone to do the following: 1. Put the logos back up (it should just be a click of a button. I just don't know which one) 2. I'd like to add two more social link to the list. (patreon & buy me a coffee) 3. I'd like for each person who signs up to get an email thanking them for joining. 4. I'd like to make it so people can't sign up multiple times with the same email address. 5. On wordpress there are numbers for each person who signs up. If I delete a person the numbers don't change order. It would be nice if they did. This isn't a major thing if hard t...
For the game Dead by Daylight, I would like someone to create an equalizer to isolate the sound of a specific character, and amplify that sound so its easier to hear while im gaming. Ideally Peace Equalizer running in the back that i can switch on and off. The sound is comparable to breathing but is more like a distinct grunting sound. There will be 3 different equalizers, with 3 different sounds at the base. The end goal would be 3 files for peace equalizer I can download. I will provide all the input, so I can send all the audio files required to make the EQs. Looking for a developer who knows how to utilize programs to translate sounds into Hz ranges & into eq's + ideally other advanced techniques I dont know about.
Looking for a seasoned SEO expert who can effectively optimize the on-page SEO for my built website. In the application, kindly include: • Examples of your past work, particularly highlighting website projects built with you’ve worked on. Ideal skills and experience: - Solid understanding of and SEO techniques - Extensive background in on-page SEO best practices - Good eye for detail in identifying SEO opportunities within a website structure.
I need a talented VB.net developer with a strong background in SQL Server. Key Responsibilities: - Develop software applications using VB.net - Efficiently manage databases - Designing, coding, testing, and debugging software applications using VB.NET. - Calling third-party API - Payment gateway integration - Stored Procedure Ideal Candidate: - Proven experience in VB.net development - Strong familiarity with SQL Server - Good problem-solving skills - Ability to work independently and meet deadlines. Please provide relevant work samples in VB.net development and describe your experience with SQL Server.
DESIGN ME AN A5 FLYER - USE TEMPLATE ATTACHED AND OUR LOGO COLOUR SCHEME- TEAL COLOUR GRAPHICS- PHARMACY BASED FLYER DETAILS BELOW:- Penhill Pharmacy 257A PENHILL DRIVE, SWINDON, SN2 5HN Opening hours: Monday-Friday ( 08:30 - 17:30 ) T: 01793 723 534 E: info AT W: How to order your repeat prescription at Penhill Pharmacy 1. Hand in your repeat slip at the pharmacy 2. Request medication via the NHS APP 3. Email us at info AT 4. Call us on 01793 723 534
I need an expert in SQL Server Report Builder 3.0 to help rejuvenate some lab reports. I require some amendments to be made to the current reports I have. Key Tasks: - Altering the way data is presented within the reports - Incorporating new fields to the current reports In the end, I need the same data results but with improved visibility and understanding. Ideal Skills: - Appropriate familiarity with SQL Server Report Builder 3.0 - Strong grasp of data visualization principles - Detail-oriented and precise to ensure report data remains accurate. Individuals that can deliver these changes precisely and quickly are highly preferred.
I'm experiencing several technical, on-page SEO issues on my website. I've identified over 50 broken links that need to be promptly fixed. Additionally, there seems to be incorrect use of H1 and H2 tags and misconfigured URLs. Skills & Experience Needed: - Expertise in diagnosing and fixing broken links - Understanding of URL configuration - Strong knowledge of proper SEO practices, specifically in relation to header tags. I look forward to restoring my site's functionality and improving its SEO.
I'm experiencing several technical, on-page SEO issues on my website. I've identified over 50 broken links that need to be promptly fixed. Additionally, there seems to be incorrect use of H1 and H2 tags and misconfigured URLs. Skills & Experience Needed: - Expertise in diagnosing and fixing broken links - Understanding of URL configuration - Strong knowledge of proper SEO practices, specifically in relation to header tags. I look forward to restoring my site's functionality and improving its SEO.
I'm experiencing several technical, on-page SEO issues on my website. I've identified over 50 broken links that need to be promptly fixed. Additionally, there seems to be incorrect use of H1 and H2 tags and misconfigured URLs. Skills & Experience Needed: - Expertise in diagnosing and fixing broken links - Understanding of URL configuration - Strong knowledge of proper SEO practices, specifically in relation to header tags. I look forward to restoring my site's functionality and improving its SEO.
I need a web designer to have my website within the right theme, to match my main page pictures. WordPress. I'm seeking a skilled web designer to create a portfolio website that primarily showcases written content. The theme of the site should aesthetically align with the main page images. Here's what I am ideally looking for: - Strong understanding and experience in graphic and web design. - Experience with portfolio web design, preferably with writer portfolios. - Intuitiveness and creativity in matching site aesthetics to given image themes. - Solid grasp of user experience to ensure optimal site navigation. The purpose of this website is to professionally showcase my written work. The design should therefore make it easy for site visitors to access,...
I'm looking for an experienced graphic designer to create a T-shirt design for an annual outing event. PLEASE READ THE LINES BELOW AND ONLY SUBMIT YOUR DESIGN IF YOU ARE CAPABLE OF DELIVERING WHAT IS NEEDED. I already ran this contest on this platform, chose a winner but was deceived by the quality of files provided. They were absolutely useless. I've had success finding great designers in in the past and for that reason only, I'm running the same contest again. Please prove I'm not wrong in trusting this platform. Only vector images will be accepted to award prize. Refrain from delivering bitmap images, JPEG, GIF, PNG, we don't want them, we don't need them. Only vector format files generated with CorelDraw or Illustrator will be accepted. This is ...
...experienced .NET programmer to add a new feature to my existing application. Specifically, I need a modification to bypass member search by using a querystring. The page concerned is this:- We wish to have a direct url that replaces the process of searching for a member (eg member no 161068) and arrives at page two directly. For example, entering 161068 in the search box and selecting Checkedandvetted then pressing 'review this company' moves the user to page 2- review your experience. This is what we want to achieve with a single url. This is so that we can provide a url like that will do the same as the previous steps. Ideal skills for this job will include: - Strong knowledge of .NET programming
I am used to creating logo designs that are set in the company and it has become my daily work and if you are willing to ask for a logo by me then I will give you the best logo.
Hi, I am a python programmer and I am trying to learn how to code with the OpenHoldem framewor...able to understand what I want my bot to do, and transcribe it in code. I already have a warbot profile so I do not need a full poker bot from scratch. Details: - the bot is going to play spin (3 players) on a poker skin already available in the warbot list - it needs to adapt based on the opponents (I will provide with a list of players against whom it has to change some choices in game) -it needs to base its choices on a few specific decisional processes that I will tell you, but they won t be complex, it will all be pretty straightforward Obviously I will tell you exactly what I need the bot to do in advance in further details, in order to avoid misunderstandings and ...
...domain. Upload over 100 products. Need seo, fraud detection, need my website to be viewed even while customers are at work in a government agency with no restrictions to entering websites. Key Features Needed: - Product Customization Options: The ability for my customers to tailor and personalize their purchases. - User Accounts and Profiles: A seamless system for users to create accounts, save preferences, and view order history. - Advanced Search and Filter Options: A robust search functionality with filters to help customers find products quickly and easily. This project will involve not just the migration of the current site but also the creation of a new domain. I need a skilled web developer who has experience with E-commerce websites, particularly on WordPress. ...
I'm looking for a skilled software developer to create a Windows application that focuses on generating data reports from a SQL database. Key Requirements: - The application must be compatible with the Windows platform - The main functionality of the application should be the generation of data reports. - The reports should be sourced from SQL database. Ideal Skills and Experience: - Proficiency in Windows application development - Strong knowledge and experience with SQL database and report generation - Previous experience with data reporting software would be a plus.
I'm in need of a Junior Full Stack Engineer who is proficient with Java, with beginner level experience. The primary task will be to work on implementing Go Live for an assigned project. Ideal skills for the job: - Understanding of Java programming language - Ability to work collaboratively on a team - JSON - XML - SQL - Data Mapping Some experience with project implementation is a plus. Dedicated beginners are also welcome to take their first steps in a real project.
I'm having an issue with the cookie bar on my landing page. It functions perfectly upon my primary website, but fails to operate as expected on my subdomain, specifically my landing page. I am using the exact same JavaScript and CSS script for both the website and landing page. All is built on custom HTML. Ideal skills for this job: - Expertise in JavaScript and CSS - Vast experience in handling cookie bars and similar web components - Ability to diagnose issues affecting custom HTML websites The selected freelancer will be tasked with: - Understanding the functionality of the cookie bar on my main website - Translating the same functionality to the landing page - Uncover and solve any underlying issues or differences causing the functionality mishap Ple...
We have a lineup of software products. Each product is represented visually by a 3D box for marketing purposes. In order to visually communicate the relationship between the different products, our client requires you to design 1 or more (e.g., maybe 2 or 3) graphics that suggest a "cable" or "connector". We will provide the original artwork for the 3D boxes to the successful coder. The "cable(s)" or "connector(s)" should be designed in such a way, with a transparent background if necessary, that they can be "dropped into" a new marketing design project, alongside any combination of 3D boxes. *** All of the specific details and requirements of this project are carefully documented in the attached .PDF file. *** There is a...
...a skilled mobile app designer who can redesign an existing android app and also make for IOS. there will be two versions (android / Ios) EDITED: this project is not only to change the color or the images to the current app. you need to know about programation in arduino, bluetooth and android ,, because this app will manage a lock using the smartphone. I send you the current android app in order that you could understand and know how the buttons work please do not offer your job if you can not open the current job and see how it works Key Requirements: - The design modifications primarily focus on be friendly and easy to use - For the user interface, I'm looking to make changes to the color scheme, font styles, and the overall layout. - In terms of functionality, th...
I am looking for a skilled Android developer who can create an engaging, robust, and seamless B2B ecommerce application for my cement manufacturing unit. Key Features: - Product Catalog: The app should showcase our comprehensive range of products for easy browsing and selection. - Order Management: A seamless and user-friendly system is required for order placement, tracking, and confirmation. - Inventory Tracking: Real-time updating of inventory for an optimal supply chain management. - SAP Integration: Capability to integrate with our current SAP system for streamlined business operations. - Order Splitting: An option to divide order in case of large demand. - Truck Ordering: Enable easy booking and scheduling for transporting bulk orders. User Role...
Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.
I'm looking for a talented article writer who can help me create engaging, detailed biographies around net worth analysis. The articles will need to cover different individuals and their professional and personal journeys. Key requirements: - Ability to research and compile engaging biographical content - Experience in analyzing net worth, and presenting it in an accessible way - Strong writing skills, with the capacity to deliver both professional and personal tones - Quality sources to back up the net worth and biography analysis The ideal candidate will have a mix of a journalist's curiosity and a financial analyst's precision. This project will offer an opportunity to craft insightful pieces on successful individuals, and delve into the fin...
I'm looking for a functional implementation utilizing AWS media convert in a .NET core environment, with a specific focus on video transcoding. - Functionalities: The main functionality to be implemented is video transcoding with the target being MP4 format. - Desired Output: The desired output resolution for the transcoded videos should be 1080p. Ideal Skills and Experience: - Significant experience with AWS Media Convert - Proficient in .NET core programming - Experience with video transcoding technologies - Understanding of video formats, particularly MP4, and resolution settings.
Hi, we need to create a picclick similar site that uses the feed of our 2 websites The site will automatically download the products by comparing and redirecting them and showing the offers of the two stores.