Creating touch screen kiosk applications vb net punët

Filtër

Kërkimet e mia të fundit
Filtro sipas:
Buxheti
deri në
deri në
deri në
Lloji
Aftёsitё
Gjuhët
    Shteti i punës
    2,000 creating touch screen kiosk applications vb net punët e gjetura, me çmimin EUR
    Html,css and js Ka përfunduar left

    responsible I am a lead frontend software engineer and for creating a mobile , web and desktop using different languages and technologies if u r interested just send me a message thank you and good luck applications

    €17 / hr (Avg Bid)
    €17 / hr Oferta mesatare
    23 ofertat

    N/a n/a n/a n/a hdhdhdndndndhdhhdhd

    €22 / hr (Avg Bid)
    €22 / hr Oferta mesatare
    5 ofertat

    ...with you. Hello, I have my own little business creating and building brands for clients. I have been offering a 360 service including branding, graphics, websites, social media and top level conceptualisation of companies, services and products as a whole and seems to be going well but I am only one person and starting feel swamped. I am starting to think about trying to turn my business into an agency of sorts and am looking to extend my team and improve the quality of my service / output.l which in term would also allow me to start to take on a more overarching creative role and take on more clients. I’m not sure this is even the right place for this post but I’m basically trying to find someone who can in effect join my team creating websites on an o...

    €13 / hr (Avg Bid)
    €13 / hr Oferta mesatare
    17 ofertat
    Programing Ka përfunduar left

    Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc

    €11226 (Avg Bid)
    €11226 Oferta mesatare
    4 ofertat
    Crie um Website Ka përfunduar left

    Desenvolvedor .NET MVC, SQL e ADVPL Protheus

    €2726 (Avg Bid)
    €2726 Oferta mesatare
    1 ofertat
    qefqreqweqawdafsc Ka përfunduar left

    asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr

    €184 (Avg Bid)
    €184 Oferta mesatare
    1 ofertat
    the touch love Ka përfunduar left

    kjdbhw;iufbkj.bvkj.;hveiuq; ugyq3p;yg vrpy h tfi iqyhifgiu 3bnrfj iih i4ht ih

    €139 (Avg Bid)
    €139 Oferta mesatare
    1 ofertat
    Mobile Applications Ka përfunduar left

    1 X Iphone App Update (Radio Umut) 1 x Android App (Radio Umut) 1 x Iphone App (Radio Bizim FM) 1 x Android App (Radio Bizim FM)

    €650 (Avg Bid)
    €650 Oferta mesatare
    1 ofertat
    yveguwvcjnjnecbkhb Ka përfunduar left

    ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif

    €105 (Avg Bid)
    €105 Oferta mesatare
    1 ofertat

    I'm looking for an adept professional to input numerical data into an Excel sheet for the purpose of data analysis. The successful freelancer should have: - The ability to efficiently type in large amounts of numerical data - Experience using Excel functionalities specifically for formulas and calculations - Proficiency in creating understandable and comprehensive charts and graphs The end goal is for me to be able to easily interpret and analyze the said data, facilitating more informed decision-making. I appreciate accuracy, organized work and adherence to deadlines. Therefore, attention to detail as well as the ability to work promptly and efficiently is required.

    €8 - €14 / hr
    €8 - €14 / hr
    0 ofertat
    Flutter UI Development from Figma 6 ditë left
    VERIFIKUAR

    ...been made in Figma, to life. Your main responsibilities would encompass: - Standalone UI development from a well-defined Figma design. - Creating custom UI components as depicted in the Figma frames. - Crafting animated transitions and effects, pushing for a dynamic and fluid user experience. Ideal candidates would have significant experience in: - Flutter development and its nuances, including effective state management techniques. - Developing visually appealing user interfaces from Figma designs. - Creating custom UI components and animations. To give me confidence in your skills, please share prior work where you've developed Flutter applications from predefined Figma designs, particularly those involving complex and custom transitions or animations. ...

    €4 / hr (Avg Bid)
    €4 / hr Oferta mesatare
    22 ofertat

    I'm in need of an Oracle database expert versed in advanced database design. Your tasks will encompass creating a comprehensive design that incorporates stored procedures, views, triggers among others. The database structure is complex, therefore demanding a mastery of the aforementioned advanced concepts. The ideal candidate should: - Have demonstrable experience in Oracle database design. - Be proficient in forming complex relationships between multiple tables. - Show competency in creating stored procedures, views, triggers, and other advanced database features. Your understanding of our needs and execution will greatly influence our company's operational efficiency.

    €8 (Avg Bid)
    €8 Oferta mesatare
    6 ofertat

    I have an exciting project that involves developing a portfolio site with three specific functionalities. Key Features: - An efficient e-commerce section: Expect to create and manage my online store seamlessly. - User registration and...user-friendly system where visitors can create their own accounts. - Content management system: A flexible way for me to update and post my portfolio is vital. Technology Preference: I prefer the site developed on WordPress due to its user-friendly interface and robust capabilities. Ideal Skills and Experience: Looking for a web developer with proven experience on WordPress, particularly in creating e-commerce websites and managing user data. An understanding of different CMS, and designing user-focused registration and login process would be b...

    €32 (Avg Bid)
    €32 Oferta mesatare
    49 ofertat

    I am in need of someone skilled in creating detailed local market reports for my targeted cities. These reports will focus specifically on different neighborhoods, here is an example link: The key requirements are: - Familiarity with MLS and creating graphs for the monthly data reports Prior experience in the real estate industry is mandatory

    €31 (Avg Bid)
    €31 Oferta mesatare
    6 ofertat

    I am seeking a resourceful developer with a strong background in ERP web app development for a project that aims to enhance our decision-making capabilities by creating a powerful and encompassing Human Resource Management module. This project involves the development of key features including: 1. Employee Record Keeping: A system for recording and maintaining all employee data accurately and efficiently. 2. ERP Interface: Seamless navigation and interaction for maximum productivity. 3. Data accuracy and visibility: An intuitive interface for data accessibility and user interaction, facilitating accurate decision making. The ideal candidate should possess proven experience in HRM and ERP systems development with an in-depth understanding of the dynamics of Employee Record Keepin...

    €107 (Avg Bid)
    €107 Oferta mesatare
    79 ofertat

    ...types, ranging from corporate entities to non-profit organizations, including start-ups. With a variety of clients, I need a logo designer who is not only adaptable but also creative and innovative. Key requirements: - Skill and experience in designing distinctive logos that suit diverse business types. - Ability to translate specific color preferences into striking designs. Your job will be creating captivating logos that reflect the unique identities of varying businesses. Regardless of the industry involved, each logo must speak out and instantly connect with its targeted audience. This role hence calls for someone with a deep understanding of the impact of colors, alongside keeping an eye on the finer details that bring together a logo. The ideal candidate will also hav...

    €197 (Avg Bid)
    €197 Oferta mesatare
    26 ofertat

    ...proactive and personable ethos. Key Requirements: - Incorporating green colour from my logo, Codex. - Company logo and core values (professional, proactive, personable) should be on forefront. - You should be experienced in creating professional, elegant and visually appealing designs. - Strong ability to work within a brand's color scheme and design guidelines. - Utilize some photos (stock photos are fine) relating to the built environment (architecture & buildings) Experience designing for LinkedIn and producing capability statements will be highly regarded. Get in touch if this project speaks to your skills and creativity. Aim to release my business in style. Logo can be found in the attached word document 'Codex Building Code of Australia'. Als...

    €50 (Avg Bid)
    €50 Oferta mesatare
    65 ofertat

    I am on the hunt for a highly creative and talented designer, with a knack for creating illustrative book covers. Key Requirements: - Conceptualize and create a design that relies heavily on symbolic imagery. - Utilize a warm color palette to bring the concept to life. Ideal Skills: - Strong grasp of illustration and symbolism - Expertise in color theory, particularly warm hues - Proven experience in book cover design Your interpretation of the symbolic imagery can be abstract or literal, as long as it fits within an illustrative style and warm color scheme.

    €176 (Avg Bid)
    I garantuar
    €176
    24 kandidaturat

    ...developer-chosen unique styles for creating next-gen videos. - It must have the capability of producing animated explainer videos, product demonstration videos, and training videos. - The generated videos are intended for a general audience, hence they need to be engaging, comprehensible, and visually appealing. - Audio in the videos is crucial, the tool should incorporate a computer-generated voice feature. Quality synthetic voice that mimics human speech is preferred. - Developer Should Do SEO of Website - Developer Should Do Advertisement of Website on Trending Platforms Like Instagram, Facebook, Youtube, Do Sponsors With Tech Influencers - I want tool like 'Runwayml', 'Heiper AI' Preferred Skills: - Experience with AI video generation tools - Proficient...

    €594 (Avg Bid)
    €594 Oferta mesatare
    4 ofertat

    We will contact you if you actually read the project details and reply to our questions. We are looking for an experienced automation engineer to customize the workflow of our machine. We are open to suggestions. Raspberry Pi 4b Delta Touch Screen (DOP-110WS) Panasonic Minas Driver (MADLN05NE) Panasonic Servo Motor (MHMF092L1U2M) Expect our reply only if you provide an answer on how you will connect the Raspberry PI 4b & Delta HMI. We need a simple HMI with option to control the torque, speed and positioning of 4 servo motors. We will provide you the sequence in which the motors should work. Also, let us know how much time you would need for this project.

    €145 (Avg Bid)
    €145 Oferta mesatare
    4 ofertat

    I am in search of a proficient Image Processing Expert who can skillfully handle python-based machine learning code within a GAN architecture. I intend to significantly enhance the quality of my project images through the application of advanced image processing techniques. ...architecture to process images * Augment, classify, and generate images as necessary Ideal Skills and Experience: * Proficiency in Python * Deep understanding of GANs * Substantial experience in machine learning & image processing Desired Outcome: The ultimate goal of this project is to significantly enhance the quality of the processed images to achieve more detailed and high-quality results. Applications should include indications of past work, detailed experience, and project proposals for careful ...

    €150 (Avg Bid)
    €150 Oferta mesatare
    7 ofertat

    ...with others in the industry Design Requirements: The logo should include the name "Drive N Style University" in a bold, professional font. Incorporate elements related to the car rental industry (e.g., cars, keys, road signs) to emphasize the educational aspect. Use colors that convey professionalism, such as shades of purple, black, and white but feel free to add a pop of color for a modern touch. The design should be clean, modern, and easily recognizable. Additional Notes: Avoid using overly complex or intricate designs that may be difficult to reproduce or recognize. The logo should be scalable to work across various platforms and mediums, from digital to print. Inspiration and References: Think of universities and educational institutions' logos for inspi...

    €19 (Avg Bid)
    I garantuar
    €19
    44 kandidaturat

    I'm in need of a Flutter UI expert who can help in creating new UI elements, specifically buttons and forms. I have precise specifications for these elements which will be provided which you will use to guide your work. Ideal Skills: - Proficiency in Flutter UI. - Experience designing and implementing buttons and forms. - Ability to adhere to design specifications while initiating creative solutions when necessary. The main aim of this project is to ensure seamless integration of these new UI elements into my existing application. Please place your bid if your skills align with the project requirements. my budget is 100 INR per hour

    €3 / hr (Avg Bid)
    €3 / hr Oferta mesatare
    11 ofertat
    App Promotion for All Demographics 6 ditë left
    VERIFIKUAR

    I'm looking for a skilled marketer to promote my photo editing application, which is available only on Android platform, efficiently across various target demographics - teenagers, adults and the elderly. The goal is to reach wider audience, increase app Down...is to reach wider audience, increase app Downloads and usage. - Marketing Strategy Development Your responsibility would be to develop an effective marketing strategy that caters to diverse age groups. - Social Media Marketing Skilled in social media platforms to ensure the application gains maximum exposure. - Digital Marketing Experience You ideally have experience in promoting mobile applications, especially within the photo editing genre. Let's see how we can work together to ensure my application reaches i...

    €81 (Avg Bid)
    €81 Oferta mesatare
    10 ofertat

    I'm looking for a graphic designer to create a sleek and modern logo for my brand, Technology For , with a strong focus on the acronym TFU. The design should strongly incorporate the blue and yellow colors of the Ukrainian flag for that touch of national pride. It's also quite crucial for the logo to embody the spirit of Ukraine through the incorporation of the country’s National Emblem into the design. Ideal Skills: * Proficient in modern logo design and branding * Experience with incorporating national emblems/flags in designs * Strong understanding of color theory With your knack for capturing the essence of a brand and your experience in modern design, I believe you could deliver a logo that perfectly symbolizes TFU's mission and vision.

    €32 (Avg Bid)
    €32
    24 kandidaturat

    ...in need of a professional with significant experience in creating highly effective landing pages for lead generation purposes. This landing page should be optimized to encourage visitors to provide their email addresses. Key details: - The primary purpose of the page is lead generation. - I wish to collect email addresses from visitors. - The call-to-action will be for visitors to subscribe to free content as a means to encourage them to sign up for our products. Ideal skills and experiences for the job include: - Experience creating landing pages optimized for lead generation - A portfolio of previous work that demonstrates an ability to create engaging, persuasive copy - Knowledge of email marketing techniques - Expertise in creating calls-to-action that drive u...

    €17 / hr (Avg Bid)
    €17 / hr Oferta mesatare
    51 ofertat

    I'm in need of an expert animator to create a engaging and dynamic YouTube banner. This animated banner should prominently feature my channel name and logo. I am open to creative liberties in design and animation as long as they adhere to YouTube's guidelines. Ideal Skills: - Proficiency in graphic design and animation - Experience creating YouTube banners - Understanding of YouTube's banner guidelines - Creativity and ability to work with minimal guidance Please provide examples of your previous work in your proposal. Looking forward to working with you.

    €95 (Avg Bid)
    €95 Oferta mesatare
    20 ofertat

    I'm on the hunt for a talented social media content creator, ideally based in the US, with a knack for designing engaging Instagram content focused on premuim merchandise. Your role will include: - Creating innovative promotional materials to showcase my range of merchandise aimed at adults - Always considering the target audience during content creation - Opting for a marketing strategy that effectively caters to the tastes of adult consumers on Instagram Ideal Experience & Skills: - Prior experience with social media marketing, particularly Instagram - Solid understanding of crafting content for adult audiences - Track record of product promotion through engaging, creative Instagram posts - Strong proficiency with design tools and Instagram's in-app features - ...

    €12 / hr (Avg Bid)
    €12 / hr Oferta mesatare
    23 ofertat

    I'm currently in need of an experienced tutor who can guide me on efficiently running Facebook ads with the primary goal to generate leads. While I'm...equipped with intermediate-level knowledge about Facebook ads, I wish to further improve my skills on Ad creation. Here's what I'm looking for: - An expert who has extensive experience in creating ads on Facebook. - Someone who can customize the sessions according to my level of knowledge and desired niche. - An instructor who can clearly explain strategies and techniques for effective ad creation that leads to conversion. The ideal tutor should be patient, a good communicator, and able to pace the session according to my learning speed. As a result of these sessions, I aim to independently generate leads by ...

    €76 (Avg Bid)
    €76 Oferta mesatare
    17 ofertat

    I'm looking for a talent that could breathe an artistic life into selected portrait and still life images. My vision entails: - Application of a painterly editing techn...and still life images. My vision entails: - Application of a painterly editing technique - Achieving a trio of Impressionist style, Watercolor effect, and Oil painting effect on each image - Delivering a moderate level of intensity in these effects so the images are enhanced yet realistic Ideal skills you'll need: - Strong understanding of digital photo editing techniques - Proven expertise in creating painterly effects - Familiarity with impressionist, watercolor, and oil painting styles Prior experience working on portrait and still life images is highly valued. I'd love to view your portfolio...

    €75 (Avg Bid)
    €75 Oferta mesatare
    56 ofertat
    Trophy icon Corporate Identity Kit Enhancement 6 ditë left

    ...should include the logo design for business cards, letterheads, envelopes, social media icons, website graphic, a LinkedIn banners, and t-shirts. - For the color scheme, a combination of green, black, and white (background) is desired. Ideal Skills: - Proficiency in graphic design tools: Adobe Illustrator and Photoshop. - Experience in creating and optimizing logos. - Solid understanding of brand identity and corporate branding. The ultimate goal is creating a strong, easily identifiable corporate identity. The right designer for this project has a solid portfolio in branding and logo development, with a knack for understanding and enhancing the visual essence of a company. Strong attention to detail, creativity, and delivery time are important factors for success in t...

    €23 (Avg Bid)
    €23
    21 kandidaturat

    I am starting a tutoring side hustle and I need a dedicated helper who can provide all the necessary help to kickstart my new endeavour. - Responsibilities will include but aren't limited to: - Creating a step by step tutoring startup plan. - Providing strategic insights to make the business profitable. - Crafting effective marketing strategies targeting potential students. - Skills and experience: - Proven experience in teaching or tutoring is ideal. - Business strategy creation. - Strong marketing capabilities, particularly within the education sector. This is an urgent request as I am looking to launch my tutoring service as soon as possible. Previous experience and quick delivery will be highly regarded.

    €29 / hr (Avg Bid)
    €29 / hr Oferta mesatare
    6 ofertat

    I'm on the hunt for an experienced mobile app developer who can bring my vision to life. I'm looking to create an interactive language learning app, ai...to create an interactive language learning app, aiming to make the learning process enjoyable and engaging. Key Features: - User-friendly learning modules - Interactive quizzes after every session - Progress tracker Desired Skills and Experience: - Expertise in mobile app development specifically educational apps. - Profound knowledge in UX/UI for intuitive user interface. - Experience in creating language learning apps would be a bonus. The goal is to create an app that is both fun and educational. Experience with similar projects is highly desirable. Looking forward to receiving bountiful proposals and starting th...

    €16 / hr (Avg Bid)
    €16 / hr Oferta mesatare
    7 ofertat

    I'm in need of a full-time female YouTube content creator who specialises in producing business-related videos, more specifically focused on the realm of marketing and encompassing all industries. Key Responsi...experience in video creation and editing - Proficiency in research methods and execution. - Proficient in producing professional, educational, and engaging videos. - Strong understanding of and experience in marketing as it connects to all business industries. - Excellent communication and content creation skills. Please include examples of your previous work when applying. Your background in creating business related educational YouTube videos, especially marketing-centric content, would be highly valuable. This will be a full-time role, so commitment and dedicatio...

    €356 (Avg Bid)
    €356 Oferta mesatare
    13 ofertat

    ...featuring well-known characters from cartoons. • Purpose: The purpose of this video is to entertain the audience through a fun and engaging 3D animation story. • Duration: The video must be more than 3 minutes long. Please ensure that it’s engaging and captivating for the entire duration. • Characters: For this project, we’ll be using well-known cartoon characters. You must have experience creating animations with known characters, respecting their original design while adapting them into our story. Ideal freelancers will have a portfolio demonstrating their skills in 3D animated videos, especially those involving cartoon characters. Experience in storytelling through animation is highly desired. To stand out, provide examples of your past wor...

    €116 (Avg Bid)
    €116 Oferta mesatare
    7 ofertat

    I urgently require help in applying for full-time jobs in USA. Ideal candidate should possess: - Experience in submitting job applications Key tasks: - Research on potential job openings - Submit applications accurately and in a timely manner Required skills: - Proficiency in English language - Excellent research skills - Good writing, typing and proofreading skills.

    €4 / hr (Avg Bid)
    €4 / hr Oferta mesatare
    20 ofertat

    I'm seeking a proficient freelancer for creating a personal WordPress site. Primarily, this site will feature a contact form, which is the main functionality I am interested in. Ideal Skills and Experience: • Expertise in WordPress site creation. • Proficient in developing and integrating contact forms. • Adequate knowledge in handling personal data safely. I look forward for your bids. Please, include examples of similar projects that you've worked on earlier for me to understand your expertise.

    €25 / hr (Avg Bid)
    €25 / hr Oferta mesatare
    16 ofertat

    Looking for talent with an eye for detail and passion for creating engaging visuals, to design a 3D Billboard that can replicate Nike Japan's Air Max Day style. Your objective is to create a captivating 3D billboard with the following specifics: - Main Goal: Make a digital splash to generate sales leads. Captivate viewers with the irresistibility of our chocolate product through the billboard, drawing customers to our brand. - Essential Elements: The billboard design should incorporate our specific brand colors. It's all about making sure our visual branding shines through in this 3D format. - Style: The 3D design should be realistic. Aim to captivate passerby's attention with a realistic representation of our chocolate box. Imagine this - someone picking up a piece...

    €106 (Avg Bid)
    Urgjent
    €106 Oferta mesatare
    22 ofertat

    I'm creating a flyer for a Risk Management Framework class, aimed to captivate the interests of any potential participants cutting across various groups of people. The flyer should be able to perform the following: - Grab the viewer's attention - Aesthetically pleasing, with a professional and clear design - Concisely provide necessary information such as: * The date and time of the class * The physical or virtual location of the class Ideal skills for this project would include: - Mastery in graphic design - Understanding of effective marketing principles - Excellent grasp of informational hierarchy in design - Previous experience in educational or event promotional material design strongly preferred.

    €21 (Avg Bid)
    €21 Oferta mesatare
    72 ofertat

    ...professional musicians, and hence, we're aiming for sophisticated functionality and an aesthetic appeal. Ideal skills & experience needed: - Proficient in industrial product design, specifically consumer electronics. - Previous design experience with musical equipment or MIDI controllers is a plus. - Knowledge in interface design to implement a user-friendly operating system. What the job involves: - Creating a design concept for a high-performance MIDI controller that features: - Velocity-sensitive keys - Drum pads - A fresh and intuitive user interface The ability to merge functionality with aesthetics is key, the design should inspire and resonate with music producers and performers while ensuring comfortable and intuitive device use. We're all...

    €51 (Avg Bid)
    €51 Oferta mesatare
    41 ofertat

    I need a talented freelancer to create an engaging advertising video using my provided script. The video will be posted on various social media platforms including YouTube, TikTok, and Meta. • Ideal Skills: I'm seeking someone with a solid understanding of video creation, storytelling, and advertising. Prior experience in creating engaging social media content is advantageous. • Application Requests: When applying, please detail your experience in video development, especially relating to social media advertisement and promotion. Note: The desired video style was not specified, hence I'm open to your professional input whether it be animated, live-action, or mixed media. Please include this recommendation in your application. Let's collaborate and brin...

    €125 (Avg Bid)
    €125 Oferta mesatare
    37 ofertat

    I require an experienced web developer who can effectively construct an interactive timetable using HTML, CSS and Javascript. This timetable is intended to showcase class schedules. The ideal professional for this project would have a strong grasp of the following: - Intuitive user interface design, ensuri...Experience with the creation of interactive elements that can deal with real-time updates The timetable must have the following functionalities: - Filtering by day, week, or month - Highlight of current time - Adding and editing of class schedules Only candidates with previous experience in similar projects and a robust portfolio of user-interactive sites will be considered. I look forward to creating an easily navigable and efficient timetable tool for class schedule m...

    €10 / hr (Avg Bid)
    €10 / hr Oferta mesatare
    38 ofertat

    I'm working on a project which requires expertise in SAPUI5, HTML5 and JavaScript/jQuery. Here are the major requirements of my project: 1. Primary Features: - Developing a responsive design - Impleme...Developing a responsive design - Implementing data visualization 2. Types of Data Visualization: - Charts - Graphs - Maps 3. Purpose of Visualization: - The main purpose is to present statistics effectively. Ideal Skills & Experience: - Proficiency in SAPUI5, HTML5, and JavaScript/jQuery - Previous experience with data visualization projects - Strong understanding of creating responsive designs - Ability to present complex statistical information through easy-to-understand visual elements - Excellent problem-solving skills and ...

    €14 / hr (Avg Bid)
    €14 / hr Oferta mesatare
    13 ofertat
    Google My Maps Specialist Needed 6 ditë left
    VERIFIKUAR

    I am looking for an expert in Google My Maps who can help me with a complex project. This person should be proficient in: - Creating custom maps - Adding markers and labels - Importing data into the maps The purpose of the maps is to share location details, display routes and directions, and visualize data. Particularly, I require a professional who knows how to utilize markers and labels optimally, with the goal of: - Highlighting specific locations - Providing supplementary information - Organizing different categories Experience in these areas is necessary as the project relies heavily on these elements. Having a strategic mindset, an eye for detail and strong data visualization skills will be key for this project.

    €71 (Avg Bid)
    €71 Oferta mesatare
    15 ofertat

    Hi there, I want a website style similar to this one ⏩ But not 100% copy paste, it is for inspiration purpose only. you as designer need add your own touch to it. Please reach out to me ASAP. Thanks.

    €107 (Avg Bid)
    €107 Oferta mesatare
    114 ofertat

    We are seeking a highly skilled and knowledgeable professional with a strong background in electrical and electronic engineering, including expertise in Arduino and power systems. The ideal candidate will be responsible for assisting with technical writing tasks and creating comprehensive PowerPoint presentations. The role demands a meticulous individual with a keen eye for detail, exceptional writing skills, and a deep understanding of electrical and electronic engineering principles. The successful candidate will collaborate closely with our team to ensure the accurate and effective communication of complex technical information. Proficiency in technical documentation and the ability to convey intricate concepts in an accessible manner are essential for this position.

    €32 (Avg Bid)
    €32 Oferta mesatare
    14 ofertat

    I'm seeking an individual skilled in both biochemistry and computer-aided drug design. Your main task will be to design novel antibodies with therapeutic applications. Key Responsibilities: - Apply your knowledge of biochemistry and computational methods - Utilize computer-aided drug design techniques - Focus on creating antibodies for therapeutic uses Ideal Skills and Experience: - Proficiency in biochemistry - Familiarity with computational methods, specifically computer-aided drug design - Experience in antibody design - Background in therapeutic applications Together, we can contribute to the advancements in therapeutic applications!

    €61 (Avg Bid)
    €61 Oferta mesatare
    3 ofertat

    I am seeking a professional with experience in creating operational zones on Google MyMaps. This project focuses on the tourist town of Cranbrook, BC, for which we are preparing Create a MyMaps Operational Zone for Cranbrook, BC: An operational zone is an area where the bike-sharing system is allowed to operate. Suggest a Designated Parking System: Identify locations within the downtown core of Cranbrook where bikes from the bike-sharing system can be parked. Define Slow Zones: These are areas where riders should reduce speed, possibly due to high pedestrian traffic or safety concerns. Designate No-Ride Zones: These are areas where riding bikes from the bike-sharing system is not allowed, possibly due to local regulations or safety issues. Incorporate Bike Lanes into the Plan: ...

    €69 (Avg Bid)
    €69 Oferta mesatare
    48 ofertat

    I require someone with in-depth knowledge of Jira to streamline the development process of our software project. We are a small team of fewer than 10 people needing assistance in laying the foundation for our project on Jira. Key Responsibilities: - Creating project boards that visually represent our progress - Configuring ticket workflows to ensure smooth transitions between different stages - Setting up user permissions to manage the accessibility privileges of the team The ideal candidate will have extensive experience with Jira, a keen understanding of software development processes, and excellent communication skills for any necessary training. Your expertise will help us work efficiently and avoid unnecessary complications.

    €14 (Avg Bid)
    €14 Oferta mesatare
    1 ofertat

    I'm on the search for a seasoned chemist or similar professional who has hands-on experience with AICIS introduction of chemicals in Australia. Here's what I require from your expertise: - Gaining approval to introduce Chemical A, Substance B, and Chemical C into Australia. - Guiding on regulatory compliance and legal requirements associated with chemical introduction in Australi...experience as a chemist, chemical engineer, or similar; preferably someone with a deep understanding of AICIS requirements. - Proven track record of successfully introducing chemicals into Australia or similar markets. - Excellent problem-solving skills and analytical approach. The main goal of this project is about importing these aforementioned chemicals into Australia. I'm looking forward to ...

    €61 (Avg Bid)
    €61 Oferta mesatare
    2 ofertat