Decompile vb exe source code punët

Filtër

Kërkimet e mia të fundit
Filtro sipas:
Buxheti
deri në
deri në
deri në
Lloji
Aftёsitё
Gjuhët
    Shteti i punës
    2,000 decompile vb exe source code punët e gjetura, me çmimin EUR
    qefqreqweqawdafsc Ka përfunduar left

    asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr

    €186 (Avg Bid)
    €186 Oferta mesatare
    1 ofertat
    yveguwvcjnjnecbkhb Ka përfunduar left

    ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif

    €106 (Avg Bid)
    €106 Oferta mesatare
    1 ofertat
    fritsee.com help on php code Ka përfunduar left

    hi i need support

    PHP
    €8 / hr (Avg Bid)
    €8 / hr Oferta mesatare
    1 ofertat

    I'm looking for a skilled developer who can create a personalized Roblox script hub for the games Pet Simulator 99, Jailbreak, and The Survival Game. Key Requirements: - Decompilation: You'll be required to decompile the mentioned Roblox games and extract essential elements for the script hub. - Auto Farm Feature: Implement an auto farm feature within the script hub that works seamlessly across all the games. - Personalized Design: Design the script hub with a minimalist theme, ensuring it's visually appealing and user-friendly. User Interaction: - The script hub should offer a graphical user interface (GUI) for users to easily navigate and interact with. Ideal Skills and Experience: - Proficient in Roblox scripting and decompilation. - Experience in developing che...

    €12 - €23
    €12 - €23
    0 ofertat

    I have a VBS script which downloads files from a server to the a folder on my local machine or onto AWS (MS Win Server 2012 R2). This script can be manually activated (double click) or via Task Scheduler. Recently the script stopped working. I think it has to do with AWS permission/read/write errors. I need to have this investigate and fixed. The person needs to understand AWS EC2 and VBS and JS scripting.

    €113 (Avg Bid)
    €113 Oferta mesatare
    10 ofertat
    Low-Code Developers Wanted 6 ditë left
    VERIFIKUAR

    ...need of developers proficient in low-code platforms to create a suite of applications. Firstly, we will need a web application, a mobile application, and an enterprise application developed. These are crucial tools for our business operations and customer interactions. In terms of functionalities, I require the following: - User authentication: The applications should have a secure login system. - Data storage and retrieval: The ability to store data and retrieve it when needed. - Integration with third-party APIs: Seamless integration with external APIs is a must. I'm expecting a relatively small user base initially, but these applications should be scalable and able to handle growth. Ideal candidates would have: - A strong background in low-code development - E...

    €13 / hr (Avg Bid)
    €13 / hr Oferta mesatare
    69 ofertat

    More details: What is the desired color scheme for the HTML emails? Vibrant colors What type of data is being displayed in the emails? Graphs and charts How sophisticated should the timeline image design be? Moderate complexity with some unique elements

    €18 / hr (Avg Bid)
    €18 / hr Oferta mesatare
    66 ofertat

    I'm seeking an experienced Android developer for a major interface update to my app. We need to facilitate a better user experience through user interface design enhancements and additional features. Key project aspects: 1. UI Design Updates: - Specifically, I want to improve the layout and navigation of my existing app. This process requires an innovative approach to enhance user experience and navigation flow. 2. Adding New Features: - Although I'm open to your expert suggestions for new features, the direction was not specified upfront. Potential freelancers must be proficient in Android development with a keen eye for intuitive, modern design. Working remotely, your ability to maintain clear communication for updates and changes on a shared session is crucial. Eff...

    €20 (Avg Bid)
    €20 Oferta mesatare
    13 ofertat

    I'm looking for a skilled web developer to assist in creating an integrated PHP/HTML code for integrating Star Micronics Cloud print. Your responsibilities will include: - Understanding the requirements of the Star Micronics Cloud print - Creating a detailed, clean, and functional code in PHP/HTML - Testing the code to ensure there is a smooth integration Ideal Skills: - Expertise in PHP and HTML - Experience with Star Micronics Cloud print integration - Skill in creating and integrating efficient codes. Please, only apply if you have a strong understanding of Star Micronics Cloud print and the ability to deliver a well-written, effective PHP/HTML code.

    €23 (Avg Bid)
    €23 Oferta mesatare
    16 ofertat

    I'm looking for a VBA expert who can help me automate the m...Automate part modeling in Autodesk Inventor - The parts to be modeled are intermediate mechanical components, such as gears and brackets - The VBA code should allow user input for customization of the parts, specifying dimensions and features Ideal Skills and Experience: - Proficient in VBA programming - Previous experience with Autodesk Inventor - Strong understanding of mechanical components and their modeling - Ability to incorporate user input into VBA code for part customization This project is perfect for someone who enjoys automating processes and has a good understanding of mechanical engineering principles. The efficiency and accuracy of the VBA code will be crucial in ensuring the successful...

    €279 (Avg Bid)
    €279 Oferta mesatare
    17 ofertat

    I have the source code for an open source tool that I need help compiling. It's crucial that the compiled tool is compatible with macOS. Additionally, I have a patch that needs to be applied. I would require concise documentation that outlines the key steps to apply the patch and compile the tool. Expertise in C, open source tools, compiling, and patch application is essential. The ability to provide clear and concise documentation is also a must.

    €22 (Avg Bid)
    €22 Oferta mesatare
    6 ofertat

    Need advanced SQL including stored procedures, functions, based on existing SQL code. Need c# coding with dojo -Ideal Skills/experience * c# with dojo * MS SQL Server proficient. * Expert in advanced SQL features like stored procedures, functions. * complex SQL queries. * generating SQL reports from tables.

    €128 (Avg Bid)
    €128 Oferta mesatare
    41 ofertat
    add custom code to booking press 6 ditë left
    VERIFIKUAR

    i wanna buy this plugin : and setting it for having this feature, for 1 of this need add custom code : need these features: 1. User area for cancel booking (unitl specific time setting) 2. Create service for specific day and time (example “Spinning Class” each monday at 10:00-11:00 am time) 3. Holiday block day 4. Limit user email / name booking only 1 time for service day/time (for this custom code ) 5. Waiting List when finished maximum capacity 6. Setting a specific range date for service example aviable / showing from start to end date

    €48 (Avg Bid)
    €48 Oferta mesatare
    42 ofertat

    Want to modify xtream ui panel based on username and password to active codes Will share vidéo to explain it : This is démo how it will be : admin admin

    €136 (Avg Bid)
    €136 Oferta mesatare
    41 ofertat
    Code reapair 9 ditë left

    As discussed on chat 150 USD limitr

    €24 / hr (Avg Bid)
    €24 / hr Oferta mesatare
    1 ofertat

    As the project owner, I am urgently seeking experienced PHP developers to enhance the capabilities of multiple open source projects. The exact projects requiring development haven't been specified, but the key components will include: Brief description: Members can also upload items (only to designated columns set by administrators). Assumption: The administration will set up a category column—Card Trading. Members who log in can upload related items to sell, but only to that column; they cannot upload to other columns. Let's break it down step by step: User Column: Modify the administrator's product management template. The administrator will set up a category, such as the Card Trading Market. Then, all items uploaded by users will be categorized under th...

    €42 (Avg Bid)
    €42 Oferta mesatare
    26 ofertat

    ...Unity Unreal Exe. - Export the video as an mp4. - Complete the job ASAP. - Include these: 1 PLM 2 AI report 3 AI Foreman 4 QA 5 Safety 6 Collaboration with each in less than 10 seconds, you should add these 6 features to the video sequence, by creating a foreman, producing an ai report via chatgpt etc. So the total time would be less than 1 minute 30 seconds. Ideal skills and experience: - Proficiency in Unity Unreal Exe. - Familiarity with Windows mp4 format. - Attention to detail and excellent time management skills. The deadline is a high priority for this project, so please only apply if you're confident you can deliver on time. The attached files plus an exe file would be all that would be provided. You can create a storyboard by feeding the existin...

    €112 (Avg Bid)
    €112 Oferta mesatare
    34 ofertat

    ...second branch does the same thing except that it pushes different bottons so the tab order is different. Having two outcomes makes the python code to difficult for me so that i why I need help. I will also have to fine tune the number of tabs after you give me the code. So branch one will have different tabs frequency than the other branch. The UI should reflect that. I am open to creative ideas on how to do this differently then I have described below. Key Requirements: This is basically like a macro, or autohotkey, (if you do a gui then I can determine the winner as soon as whoever finishes first with working code, wins. The gui for the python code is up to you but maybe it could work well if I can have section one establish focus on right scrolling ...

    €42 (Avg Bid)
    I garantuar
    €42
    8 kandidaturat

    For this project, I'm seeking a skilled professional who is proficient at integrating composite animation videos. You'll need to be able to: - Generate an animation video with a file ported using Unity Unreal Exe. - Export the video as an mp4. - Complete the job ASAP. - Include these: 1 PLM 2 AI report 3 AI Foreman 4 QA 5 Safety 6 Collaboration with each in less than 10 seconds, you should add these 6 features to the video sequence, by creating create a foreman, producing an ai report via chatgpt etc Ideal skills and experience: - Proficiency in Unity Unreal Exe. - Familiarity with Windows mp4 format. - Attention to detail and excellent time management skills. The deadline is a high priority for this project, so please only apply if you're confident you c...

    €110 (Avg Bid)
    €110 Oferta mesatare
    38 ofertat

    We are looking for an expert for static site generation using faustj...headless WordPress in a monorepo project. Data fetching is done using graphQL. We already have all required react components for the site, but the components need to be moved into a reusable, independent ui library (including build scripts). We use Storybook which should import components from the ui library. We use styled components as css-in-js solution in our react components. We use graphql code generation to generate typescript types from our fragments. Static site generation should make use of SSR and server components. The coding is more than half done. We are looking for someone, who has already made all the mistakes, and guide us. My backend dev scope the project for 2 days. If it takes longer, we will ...

    €482 (Avg Bid)
    €482 Oferta mesatare
    107 ofertat

    ...to guide a transformer model to generate code-mixed sentences. Specifically, we are targeting basic code-mixing complexity - inserting words from one language into another. Key Responsibilities: - Develop and fine-tune a transformer model for code-mixing at a basic level - Implement the model in a way that can generate code-mixed sentences effectively Ideal Skills and Experience: - Strong proficiency in Python programming - Proven experience with NLP and transformer models - Familiarity with code-mixing and its linguistic aspects would be a plus - Good understanding of basic code-mixing complexities - Ability to design, implement, and evaluate NLP models This project is ideal for someone who is passionate about NLP and has a keen interest in ...

    €40 (Avg Bid)
    €40 Oferta mesatare
    6 ofertat

    I'm seeking a skilled professional capable of converting GPT chats with code samples into interactive, running HTML pages. This project requires: 1. Expertise in HTML, JavaScript, JSON, GitHub, retrospective mobile display and the use of ChatGPT. 2. Proficiency in transforming chat scripts with intermediate level programming concepts into functional code. 3. The ability to generate dynamic HTML pages from these chats, complete with buttons that trigger specific code executions. This is aquick and challenging, yet rewarding task for those interested in innovative ways of transforming GPT chat conversations into executable, interactive web pages. Result will be stored as a github project, We will send invitation to awarded freelancer. Current budget is 62$+...

    €126 (Avg Bid)
    €126 Oferta mesatare
    34 ofertat

    I work for a security company. We needed a spreadsheet to track security units and track what they're doing. I have the code almost perfect, but it's buggy enough that it's hard to use. There's quite a bit of backend code and intermittent problems with it. I need someone who is great at project code to look at it, troubleshoot it and make it more user friendly.

    €21 (Avg Bid)
    €21 Oferta mesatare
    28 ofertat

    I require a 3D design for charcoal briguettes bag with source in PSD. - English written - Sample of the bag is in the attachments. Same style - Include used fonts in the source file - Transparent background - Bag color: Black - Name: KING OF FIRE - Slogan: Premium Charcoal - Details to be added: 3 hours of lasting time (under the logo somewhere), 10 KG (at the bottom) - Add a icon or logo of a charcoal that is burning under the slogan.

    €9 (Avg Bid)
    I garantuar
    €9
    22 kandidaturat

    ...developing an AI Chatbot using the ChatGPT API integrated with Langchain, primarily for Customer support purposes. I'm looking for expert advice on enhancing and refining the existing code in the following key areas: - Handling User Input: I need guidance on improving the bot's ability to understand and process a wide variety of user inputs smoothly and effectively. - Generating Accurate Responses: I require assistance in fine-tuning the bot's response generation to ensure it provides relevant and accurate information to users' queries. - Performance Optimization: I am seeking recommendations on how to optimize the code for better speed, efficiency, and overall performance. The level of customization I'm aiming for in the Chatbot's responses...

    €120 (Avg Bid)
    €120 Oferta mesatare
    30 ofertat
    .NET Developer for Code Update 5 ditë left
    VERIFIKUAR

    I am in need of a skilled .NET developer, someon...gateway integration, ideally familiar with 2D/Sekretpay. - I've made modification to the code that should enhance the existing functionality of my project. Specifically, this is regarding a custom payment gateway where I have changed the API token. - Your role will be to assist in updating this code on the .NET framework, ensuring that changes made don't compromise any other functionalities. - Ideally, you should have prior experience in working with .NET and specifically in the realm of payment gateways and handling API changes. This will allow you to understand the complexities of the job better. If you believe you've got the skills and experience needed, I'd love to hear from you. Let's g...

    €157 (Avg Bid)
    €157 Oferta mesatare
    34 ofertat

    We are in search of a skilled PHP developer to assist us in optimizing the code of our WordPress plugin based on feedback from WordPress. The ideal candidate should have a strong background in PHP development, particularly within the WordPress ecosystem, and be familiar with best practices for plugin development. Responsibilities: - Review and analyze feedback provided by WordPress on the performance and quality of our plugin code. - Identify areas for improvement and optimization within the existing codebase. - Clean and refactor code to enhance performance, security, and maintainability. - Collaborate with our development team to implement necessary changes and improvements. - Conduct thorough testing to ensure that the plugin functions correctly after optimizations...

    €113 (Avg Bid)
    €113 Oferta mesatare
    41 ofertat
    Cheat for VB Game 4 ditë left

    I am looking for a developer who is versed in Visual Basic, with a nuanced understanding of how to create in-game cheats. Specifically, I need a cheat developed for Game A that will run on a Windows PC. The cheat should offer two important features: - that has no interval In addition to the above listed features, the cheat should also enable a Wallhack function, allowing players to see through obstacles that would normally impede their vision. Desired Experience and Skills: - Prior experience in creating game cheats, preferably on a Windows PC platform. - Strong expertise in Visual Basic. - Deep understanding of Game A's coding structure. - Knowledgeable about crafting reliable cheats that won't cause game crashes or banning of users. Finally, I expect the cheats to funct...

    €149 (Avg Bid)
    €149 Oferta mesatare
    12 ofertat

    I'm looking for an experienced Webflow developer to update certain sections of a website. 1. Scroller section with right side image sticky to be created. You may copy and use public webflow templates to acheive this but match colour and font of existing site. 2. Addition of headers and titles in some sections Make sure all work is responsive Please see drive for exact work - Please give exact bid and timeline. Would be great if you can start work now.

    €48 (Avg Bid)
    €48 Oferta mesatare
    9 ofertat

    I'm in need of a developer who can compile a Windows Exe file for the Real-ESRGAN GitHub project. The Exe file should operate on CPU, and accept command-line. Currently, the GitHub project offers only a GPU exe file, hence the need for a CPU version. GitHub link for Real-ESRGAN:

    €38 (Avg Bid)
    €38 Oferta mesatare
    5 ofertat

    I’m currently seeking a skilled web developer to help convert PUG code into HTML code for my ongoing project. The primary goal is to maintain the existing design format while ensuring the HTML version functions seamlessly. To accomplish this task swiftly and professionally, the ideal freelancer should: - Have a solid understanding and relevant experience of both PUG and HTML. - Be adept at maintaining the original design while converting from PUG to HTML. - Have a knack for inserting dynamic elements such as interactive forms into the converted HTML code. A demonstrated ability to pay attention to detail and deliver within a specified timeframe will be highly regarded. Additionally, a background in user-centric design could be beneficial.

    €22 (Avg Bid)
    €22 Oferta mesatare
    44 ofertat

    As a developer versed with JavaScript, your mission is to break down my comprehensive project code into distinct components and push them into multiple repositories on Git. Key Tasks: • Deconstruct the overarching JavaScript codebase into its constitutive components • Create separate repositories for each of these components on Git • Implement the Gitflow workflow throughout this undertaking Ideal Skills: • Strong competence in JavaScript programming • Familiarity with code decomposition and the Gitflow workflow • Experience with creating and managing multiple repositories on Git. Your expertise in JavaScript and meticulous Git management will be instrumental to the success of this project.

    €30 (Avg Bid)
    €30 Oferta mesatare
    24 ofertat
    Code repair 7 ditë left

    5 codes as discussed

    €141 (Avg Bid)
    €141 Oferta mesatare
    1 ofertat

    Python refactor code, change logic for the investment strategy

    €38 (Avg Bid)
    €38 Oferta mesatare
    1 ofertat

    I have an existing small carport enclosure that needs to be brought up to code standards. It is currently made of wood and I would like to include windows as part of the design. Key Requirements: - The carport enclosure needs to be assessed and re-designed if necessary, ensuring it meets all relevant building codes. - Windows need to be incorporated into the design without compromising the structural integrity. - The use of wood as the primary material will need to be considered and any necessary adjustments proposed to ensure it's compliance with the code. - The enclosure must maintain its functionality as a carport while meeting all code requirements. I'm looking for a professional who has experience in architecture and compliance with building codes, wit...

    €404 (Avg Bid)
    €404 Oferta mesatare
    33 ofertat

    I need an Excel expert to build a tool that can automatically validate and correct any incorrect country codes in the file. Requirements: - Replace incorrect country codes: The tool should replace the incorrect country codes with the correct ones. - Predefined list: The correct country codes should be determined based on a predefined list. - Daily updates: The tool should be able to handle daily updates. Ideal Skills and Experience: - Advanced Excel skills: You should have a deep understanding of Excel functions and VBA programming. - Data validation: Experience with data validation and manipulation in Excel. - Attention to detail: It's crucial that the tool is accurate in identifying and correcting country codes. - Timely updates: Experience in creating tools that can handle dai...

    €15 (Avg Bid)
    €15 Oferta mesatare
    27 ofertat

    I need a Python code developed for vehicle route optimization. - The code should include 3 algorithms for route optimization. - Successful freelancers should include past work in the application. Ideal Skills: - Proficiency in Python - Experience in developing route optimization algorithms - Strong background in data analysis, web scraping, and machine learning, as these functionalities will be required in the project.

    €158 (Avg Bid)
    €158 Oferta mesatare
    52 ofertat

    I will explain my project details in the chat

    €90 (Avg Bid)
    €90 Oferta mesatare
    5 ofertat

    I'm looking for a skilled PHP developer to create a code editor plugin. The plugin should replicate the functionality of the Shopify code editor, offering Syntax Highlighting, Auto Complete, Error Detection, and supporting both HTML/CSS and PHP languages (PHP support is optional). The plugin is intended to be a standalone component, not embedded or replacing any existing editor. the editor should include a file search (to search through templates) - similar to shopify but as well as searching filenems it shoudl also search in contents The editor shoudl work with a master theme/child theme style system such that when a template is modified its auto-copied to the child theme Key requirements: - Develop a code editor plugin similar to Shopify's - Implement Sy...

    €463 (Avg Bid)
    €463 Oferta mesatare
    178 ofertat

    ...Python 3 code for our JFrog Artifactory setup. It currently handles the basic tasks of downloading, uploading, and moving our libraries, but unfortunately, it leaves quite a bit to be desired in swift performance, overall stability, and error handling. Here's what I am ideally anticipating: - Speed up Performance: We need our code to execute operations at a faster clip. - Enhance Stability: The code needs to run reliably without crashing or running into instability issues. - Improved Error Handling: The implementation of stronger, more effective error handling is a must to solve unexpected incidents. Your proficiency in Python, especially Python 3, is crucial, and prior experience in tweaking JFrog Artifactory is going to be billed as a huge plus. Your...

    €91 (Avg Bid)
    €91 Oferta mesatare
    20 ofertat

    Details are provided in the attached files. Please read them all!

    €31 (Avg Bid)
    €31 Oferta mesatare
    13 ofertat
    Python Code Generation Specialist 3 ditë left
    VERIFIKUAR

    I'm seeking a Python expert with a focus on code generation. Key Skills and Experience: - Extensive experience in Python - Automation and code generation expertise - Demonstrable background in improving code quality - Ability to streamline repetitive tasks - Strong understanding of enhancing productivity through coding Please provide examples of your past work and demonstrate your experience in code generation.

    €198 (Avg Bid)
    €198 Oferta mesatare
    23 ofertat

    I need help using Squareline Studio and having arcs that are displayed on a touch screen to print their values to the serial monitor of Arduino IDE

    €141 (Avg Bid)
    €141 Oferta mesatare
    7 ofertat
    Excel QR Code Generator 3 ditë left
    VERIFIKUAR

    I'm looking for a solution to generate QR codes within an Excel document. The QR codes will be primarily used for URLs. The Attached Document Need Text Data from "Sheet Data" Column A into B2 Need Text Data from "Sheet Data" Cloumn B into A11 as a QR Code Need Text Data from "Sheet Data" Cloumn C into G1 as QR Code The data will be manually pasted into "Sheet Data" I need this for 50 Sheets Pages to ignore Coverpage, Inside and Page Breaks Key Requirements: - Ability to generate QR codes in Excel: The end product should be an Excel script or add-in that can create QR codes based on the URLs provided. - Implementation of standard QR codes: Custom designs are not required. The focus is on generating functional, standard QR cod...

    €12 (Avg Bid)
    €12 Oferta mesatare
    38 ofertat

    I'm in need of a professional to assist in C code writing for my PSoC Creator project. The main task will be to handle the dump and write operations to an I2C EEPROM. You can read the document I upload and Ican send you the part of accelerator which I have wrote successfully. The key responsibilities include: - Developing the necessary algorithms for the dump and write operations - Configuring the necessary peripherals to enable communication with the I2C EEPROM - Implementing interrupt handling for efficient operation The ideal freelancer for this project should have: - Previous experience with writing C code for PSoC Creator projects - Proficiency in handling I2C communication - Strong skills in algorithm development and peripheral configuration

    €77 (Avg Bid)
    €77 Oferta mesatare
    9 ofertat

    I urgently need an experienced web developer to build an innovative software-themed website. Your responsibilities will include designing and implementing aesthetic, responsive web pages, database management, testing for website functionality, and ensuring user-friendly interfaces. Expertise in JavaScript, CSS, HTML, and web protocol knowledge is required. Familiarity with software-related topics is a plus. Please note, the website's exact purpose remains to be specified - we'll develop this during our creative process. Let's work together to create something extraordinary!

    €14 / hr (Avg Bid)
    €14 / hr Oferta mesatare
    34 ofertat

    I am seeking a skilled freelancer who can convert my Python script code into JPEG images to improve its overall presentation. Key Responsibilities: - Convert Python script code into JPEG images - Ensure the output images retain the code's clarity and legibility Required Skills and Experience: - Proficient in Python coding language - An understanding of JPEG imaging format - Strong experience in code conversion - Attention to detail to retain code's legibility The ultimate aim of this project is to enhance the code's visual presentation without compromising on its readability. Only experts with relevant experience should apply.

    €13 (Avg Bid)
    €13 Oferta mesatare
    12 ofertat

    I have a proprietary program that was originally written in C# for Windows and I need a skilled coder to decompile it, incorporate some new features, and recompile it. The new features to be integrated are: - Paint Tool - Erase Tool - Selection Tool - Zoom in and out feature - Ability to resize the software windows The ideal freelancer for this job should have a strong understanding of C# and Windows programming. Proficiency in reverse-engineering and decompiling software is a huge plus. Strong communication skills are essential to ensure that the added features are seamlessly integrated into the software without compromising its functionality.

    €331 (Avg Bid)
    €331 Oferta mesatare
    21 ofertat