Finance project free sourse code vb net punët
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
gdgkiuukgklgkjdgkgdhgghsgjkhfejfghjksdbjidshbkfjlndjhkjdnfkjdghuifnbjklfhdisjnfjdhfihjhejhkdlnfjdnfljkrhfiujnlknduiherionfgioehfienmihsdlkfmdkfukdmkduyfkdntdghifjhrjgbiodghjkfnfgjidhjifnrjkovhdjignjrkhfijrngjrghjrbguierygfiu5ntguiryfiorngurehgoirghurehngjkrhguiorhntiorhg8rntgjkfhguoitngijigmtighujtihgmtigujrijtgsopjdfigkjfiogbujtrikgjfiobvjhkrgjmndiohgkrmngkofjhgkotmngkjlfyotjrngjmdgifuhbdkjfhgdgjkdfhjkdhfjshgjerhyuiotyheruyhudjnmd,nvuidfy984yhoen huifyhry9erhfjhdughrgtnr hyeouifyhr tyry rguy ru grtiorhfgir ng r tr u9r fr f9ryurohfdghdfkjhffdjhrwhiorhrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrr hrjlklllllllllllqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeee...
Retrieve website source code (Css, html, JS). Website need it to be working on local machine. Use free domain & free hosting service to host the website. Check out this website: Must type "orange" in the proposal. Project must be done within the budget. Project will not be awarded to those who bid less then increase the rate.
I am searching for a talented designer to craft a modern, eye-catching logo that combines text and symbolic elements. This logo will serve as the visual representation of my company in the advisory asset management and investment industry. The ideal designer for this task will have a proven track record in designing unique, compelling logos, preferably with experience in the finance sector. In particular, the skills I am looking for include: - Creativity and innovation in logo design - Understanding of the investment industry - Effective use of symbolism in design - Ability to create a strong visual brand identity
I'm looking to hire an experienced app developer, proficient in both iOS and Android platforms. The main focus of the project is testing and upload of code for play store verification as the code and interface is already done. Ideal Skills:. • Expertise in iOS and Android App Development, testing and upload on play store and app store • Experience in designing reward-based systems Key Features I expect: • A fully functional reward system to incentivize referrals. Feel free to bid if you meet these criteria and are ready to work in a collaborative and agile environment.
As the initiator of this project, I'm on the lookout for an intermediate-level VBA specialist. I am looking for someone who have Finance background, While the specific tasks were not laid out, the hired freelancer should be comfortable with various activities, including but not limited to automating data entry, generating reports, and creating macros. The key skills and experience required include: - Proficiency in Visual Basic for Applications (VBA) programming language. - Ability to automate tasks, create macros, and produce reports using VBA. - Demonstrated experience in a similar role or project. Please highlight your experience in your application. Remember, your ability to showcase your skills and past success in this area will significantly impact the...
I am seeking a finance expert with a focus on financial planning and real estate. I have two assignments that urgently need your expertise, within a strictly adhered to deadline. Thank you.
...in interacting with decentralized finance (DeFi) protocols, specifically Tornado Cash. The goal is to develop a bot that enables users to interact easily and securely with this DeFi protocol directly through Telegram, similar to the "tornado-cli" tool, but accessible via a Telegram bot. Project Requirements: Telegram Bot Development: The bot should be capable of interacting with the Tornado Cash protocol to execute transactions and queries securely. Specific Technologies: Experience with Telegram bot frameworks such as grammY or MTProto (MTKruto) is valued to speed up development. Security: Given the interaction with a DeFi protocol, implementing robust security measures to protect users' transactions and data is critical. Delivery Timeline: The proje...
We are looking for an experienced C#/.NET developer to fix issues for the existing Inventory management app. The app was integrated with the MySQL database. Requirements - C#/.NET Framework - desktop application development - MySQL database
I need a seasoned professional to modify certain aspects of my invoice, focusing on the charges/costs. This duty requires: We would like to remove the quantity, units, GST and amount, just leaving the description and total amounts - The ability and precisi...requires: We would like to remove the quantity, units, GST and amount, just leaving the description and total amounts - The ability and precision to add/remove items on the invoice. - Specifically, adjustments will be centered on the charges or costs. - The task necessitates revision of existing charges/costs, not the introduction of new ones. Ideal candidates have experience in accounting, finance, or a related field and are meticulous, detail-oriented, and have excellent knowledge of various invoice formats and app...
I ...need of a freelancer with a strong background in recruitment, particularly within the finance industry. Your task will be to recruit senior-level candidates with a solid foundation in Financial Analysis, Risk Management, Investment Management, as well as Record to Report. Key Skills and Experience: • Proven experience in senior-level recruitment • Deep understanding of the finance industry • Ability to identify potential candidates with expertise in Financial Analysis, Risk Management, Investment Management and Record to Report Your contribution will be instrumental in helping to find the right candidates who can drive our financial strategies and initiatives. If you have a proven track record in finance recruitment, your expertise is needed. L...
I am looking for a skilled Flutter developer to create a mobile application for both iOS and Android ...looking for a skilled Flutter developer to create a mobile application for both iOS and Android for my existing .net web project. The application will have the following features: - NFC and QR code scanning functionality for gathering information. - Ability to create points of interest that can be viewed on maps. - Real-time location tracking. Ideal Skills: - Proficiency in Flutter Development, .Net, and familiarity with NFC and QR technology. - Prior experience in creating map-based applications. - Knowledge of Turkish language, as the app will only support Turkish at this stage. Please provide examples of your previous work related to these technologies...
I need someone to help me to write a simple code by C programming language.
I'm seeking an experienced STM32 developer who can assist me in developing a small code for a vending machine that operates in three states. It is a small project which only needs a demonstration. The code is required in couple of hours, so bid only if you can work immediately. Thanks for consideration.
I'm seeking a skilled web3 developer to construct an informational website for me. This project will require experiencing in building and managing dApps, particularly in the realms of finance, decentralized marketplaces, and games. The website will need to be capable of integrating with the Metamask wallet, allowing for seamless interaction with these dApps. Key tasks will include: - Developing a user-friendly informational website - Integrating a variety of dApps from different sectors - Ensuring Metamask wallet compatibility The ideal candidate has a background in web3 technology with proven experience in dApp integration and Metamask connectivity. A flexible approach to the project is required, as I anticipate future changes and additions to the site. Lookin...
I need a landing page designed for my company, which can be accessed via a QR code and a direct web address. The main purpose of this landing page is to provide information about the company. Specifically, it should prominently display: - Our current location - Future locations - Menu - Contact info The navigation menu should be intuitive and include these elements: - Home - About Us - Services/Products - Locations - Contact Ideal candidates for this projects should have experience in responsive web design, and a strong understanding of UI/UX principles to promote smooth site navigation. A solid background in SEO to optimize the page for search engines will be an added asset.
...an experienced Python developer to optimize and automate my existing Python functions. This role does not only involve data analysis; it also involves file manipulation and web scraping. Now let's check out what you'll be working on: - Revamping Function: The existing function needs to be automated so it works effectively and efficiently. This includes working with modifying and optimizing the code. - Mobile Signature: Another crucial area you'll be dealing with is to implement mobile signature in the script to facilitate its operation. - Task Automation: The function should be programmed to undertake specific tasks. These include fetching data from a website and updating a database accordingly. Ideal Skills: - Python scripting - Mobile signature implementatio...
In this project, I am seeking an expert to consult on low/no-code Android app development. As I'm currently unsure which avenue to pursue, your guidance will be instrumental in selecting the proper tool suitable for my app. Key services that will be needed include: - Detailed recommendations on low/no-code platform choice. - Guidance on moving from low/no-code platform to Playstore. The ideal candidate should have: - Experience with various low/no-code platforms. - Strong grasp of Android app development. - Ability to provide clear and actionable advice. If you can demystify Android app development on low/no-code platforms and guide me in the right direction, I'm looking forward to hearing from you.
As someone requiring assistance in managing my React Native code, I'm looking for a skilled GitHub manager to not only set up my GitHub repository but also handle code reviews and feedback. Although I have no specific guidelines or requirements concerning the code review process, the ideal candidate should: - Set up a GitHub Repository - Help or guide us to Upload the React Native Source Code to GitHub - Help or guide us to open the code review and valuable feedback Efficiency, attention to detail, knowledge of handling React Native code, and experience in managing GitHub repositories are essential skills for this project.
I have an intricate Python code focused on algorithm implementation. My primary aim is to have this code converted to Scheme language. This initiative is part of my learning process for Scheme programming. The complexity of my Python code is quite high. It contains several modules and dependencies that need accurate and expert conversion. Due to the complexity of the task, the ideal freelancer should be proficient in both Python and Scheme languages. Key Job Requirements: • Strong Python programming skills • Expertise in Scheme language • Experience with complex code conversions • In-depth understanding of algorithm implementation • Experience with handling multiple modules and dependencies Your solid understanding of the two langua...
I'm looking for a proficient writer to accurately condense and summarize an article. The topic lies within the general domains of Technology, Health, or Finance, hence some familiarity would be beneficial. However, the specific subject matter will be provided once we move ahead. Your assignment will be to: 1. Read and understand the full article. 2. Summarize the key points and relevant details into a 1000-word summary. Ideal Skills and Experience: * Proven article writing/sample summaries of past work * Excellent understanding of Technology, Health or Finance domains * Ability to convey complex details clearly and succinctly. I request interested freelancers to include samples of their past work in their applications. This is a great opportunity for somebody who lov...
... and finance. Job Description: We are seeking native English speakers from the US, UK, and Australia to join our team as Call Center Data Collection Agents. As a Call Center Data Collection Agent, you will be responsible for engaging in natural conversations over the phone on a wide range of topics to help us collect diverse call centre data. You will play a crucial role in gathering audio recordings that will be used for sentiment analysis and behaviour identification purposes. Responsibilities: -Engage in natural conversations over the phone on various topics as instructed. -Collect audio recordings from call center interactions following specific guidelines and requirements. -Ensure high-quality audio recordings with clear speech and minimal background noise. -Adhere to ...
...6-12. Our program details can be found on: We have trained hundreds of US children online and have excellent testimonials. We can send an info pack to interested clients. Your ad should have a strong Call to Action that will drive parents to complete the Enquiry form on our website. You can find ideas for the content by searching the net with the key words: MIDBRAIN ACTIVATION that will bring up companies that promote similar programs: 1) Seeing without eyes 2) Quantum Speed Reading. We plan to place the ads on Florida Newspapers The key message to convey is the fun and educational activities for children. A successful copy should be able to: - Effectively communicate the benefits and
...branding, focusing on the finance sector. - My main aim is for the logo to create a professional image. - The style should be abstract, symbolising my unique approach to tax preparation and credit repair - Please incorporate gold, white, or a classy combination of other colours that align with the abstract design. - Aside from the logo, marketing materials are also needed: stand-up banners, business cards, and flyers. - The logo will be prominently featured on my website and merchandise, including apparel. I'm building a brand, I'm a financial consultant. I specialize in tax preparation & Credit Education. I need a logo to put on my websites, as well as merchandise, and apparel. I need stand up banners, business cards and flyers. The Name of my Brand is Pro F...
I have a C project that needs to be delivered by tommorow. I need some EXPERT in C to help me finish this. Most part is done. Analytical details in chat. Budget: $65 USD
...developer who could significantly improve an existing Android application built on .NET with SQL backend. Major tasks include: - Redesigning UI/UX to make the app more intuitive and user-friendly - Adding more interactive elements to keep users engaged - Improving navigation for a flawless user experience - Identification and fixing of bugs, coupled with performance optimizations for a smooth application flow - Integration of new features such as push notifications, in-app messaging, and creation of 'Course Sections', Course Notes Section - Reworking of the 'Find Jobs' section to make it more efficient - And with complete new Login and Sign pages. Ideal freelancer should have: - Extensive experience with .NET, SQL, and Android app development - Pr...
... and finance. Job Description: We are seeking native English speakers from the US, UK, and Australia to join our team as Call Center Data Collection Agents. As a Call Center Data Collection Agent, you will be responsible for engaging in natural conversations over the phone on a wide range of topics to help us collect diverse call centre data. You will play a crucial role in gathering audio recordings that will be used for sentiment analysis and behaviour identification purposes. Responsibilities: -Engage in natural conversations over the phone on various topics as instructed. -Collect audio recordings from call center interactions following specific guidelines and requirements. -Ensure high-quality audio recordings with clear speech and minimal background noise. -Adhere to ...
Objective: understanding Black-Scholes model and its limitations, applications. Itaims to deepen the understanding of the Black-Scholes model, its foundational assumptions, mathematical underpinnings, practical applications, limitations, and the model's impact on financial engineering and the broader field of finance. Please conduct an independent analysis, supported by academic literature, to critically evaluate the model and its relevance in contemporary financial markets. Instructions: 1. Introduction to the Black-Scholes Model (please develop this part it is the most important for me with the conclusion) : o Provide an overview of the Black-Scholes model, emphasizing its historical development and foundational assumptions. o Discuss the economic rationale behind the mode...
Key Tasks: - Establish an API with to facilitate workflow automation. - Integrate and automate transmission of data between open ai and my backend Qualifications: - Experience with ,OpenAI, and my backend. - Knowledge in automated workflow design and execution. The project's goal i...Qualifications: - Experience with ,OpenAI, and my backend. - Knowledge in automated workflow design and execution. The project's goal is to automate specific processes within my workflow, focusing on data transmission between APIs and condition-based task execution. You'll need to demonstrate familiarity with and proficiency in managing and integrating APIs. The successful execution of this project requires a solid understanding of workflow automation and data integration strategies...
I have a need help with a cost analysis test. Key details: - A comprehensive breakdown of salaries and wages for analysts. - Analysis of employee benefits and their costs for the same job position. Ideal skills and experience: - Proficiency in cost analysis and business finance. - Previous experience in HR or payroll functions would be an advantage. - Knowledge of the standard benefit packages provided to analysts. The goal of this project is for us to gain a clear understanding of our labor expenditure for analysts and make informed decisions based on that data.
I am in need of a versatile trading bot that can assist me in the stock and cryptocurrency markets. I'm an intermediate level trader, seeking a solution that boasts two specific capabilities: 1. Technical Analysis: The bot should provide insightful technical analysis to guide informed decision making. Proficiency in assessing market patterns, trends, and indicators will be id...bot should be equipped with machine learning technology. It needs to learn from historical data to make predictions about future price movements. Ideally, the prospective developer has a solid understanding of trading algorithms, expertise in both technical analysis and AI technologies, plus experience in financial markets, particularly stocks and cryptocurrencies. Knowledge of finance is crucial fo...
Attention. Those who are ready should apply. People who only send requests should not apply. I am looking for a Cora PHP specialist who can add VIEWS code to the control panel. When the news articles are viewed by the users, it should be displayed in the control panel. Views should not be repeated, it should remember the user's ip address or device
...Elixir developer well-versed in troubleshooting and correcting open source code, specifically for Mobilizon—an event planning platform. There's an immediate need to address bugs and errors affecting both the User Interface (UI) and functionality of the platform's features. Key areas that require attention: - Resolve UI issues tilted towards the incorrect computation of available seats for events - Address the affected functional features associated with UI errors See this link for details of bugs: (note that the project owners have quoted a 500 euro fee to fix this themselves, but this is excessively high for something that is small code fix.) Will provide SSH access to my instance of Mobilizon to troubleshoot
I'm seeking a content writer with a strong understanding of SEO and the mortgage industry to produce educational and promotional content for our new upcoming website. You shoul...include: - Mortgage rates and terms - Down payment requirements - The loan application process - Benefits of working with a mortgage broker - Options for refinancing - Understanding the debt-to-income ratio Expertise in SEO is crucial, as the objective is to increase our website traffic, as well as educate potential clients and promote our services. The successful bidder should have experience in finance or real estate content writing. Knowledge of the mortgage industry will be highly favorable. Craft your creative and engaging content with an SEO-focus to support our business while providing value t...
I am seeking a beginner level telecaller primarily for lead generation in the financial services industry. Key Responsibilities: - Conduct outbound calls to prospects - Qualify leads and set appointments - Detailed record keeping and updating the lead status Ideal Candidate: - Beginner level experience in telecalling - Interest or background in finance can be advantageous - Strong communication skills - Competence in lead generation and appointment setting
... Specific requirements include: - Integration with Google News API, Yahoo Finance API, and Reuters News API for article sourcing. - Automatic publishing of articles covering chosen topics, with no manual intervention needed. - Display of specific information within each article, such as company stock prices, financial indicators, and economic indicators. Key skills and experience required include: - Extensive WordPress development experience. - Proficiency with Google News, Yahoo Finance, and Reuters News APIs. - Knowledge of financial markets, particularly regarding stocks and crypto. - Background in creating automated content systems. This project poses an exciting challenge for those who understand finance, are skilled with WordPress, and have a knack...
...with a project. I have a budget of INR2000 and a timeframe of 3 days for this task. **Project Overview:** I have a PHP Laravel source code that includes a licensing program, and I am looking for a talented developer to remove the entire licensing mechanism. Once the licensing program is successfully removed, I expect the freelancer to hand over the complete source code. I can provide a hosting package for testing purposes, or the freelancer is welcome to use their own hosting account. **Deliverables:** 1. Removal of the licensing program from the source code. 2. Handover of the complete source code. 3. Testing on provided hosting or freelancer's own hosting account. **Additional Requirements:** I request detailed change logs documenting ...
Project Description: The task involves sourcing free online images of sneakers and Apple products, including Macs, iPads, and Apple Watches, from websites such as Unsplash, Pexels, and Pixabay. Each image should be accompanied by a hyperlink leading to a website hosting the image, specifically Google Photos. An example is provided in the Excel sheet. Additionally, the release price of each sneaker should be listed in the Excel sheet. For instance, Nike's Air Jordan 3 was released in 2023 with a price tag of $200. I am willing to pay a reasonable price for this work. Furthermore, if the job is done well, I have more work to offer. The excel sheet is attached below. Sincerely,
It is necessary solve some few errors that have my application. It is necessary experience in laravel coding. Please send me your experiences in complex coding not simple web). If you show me the experiences, I will send the details of changes
I'm looking for a creative and experienced designer to create a high-converting landing page on Go High Level (GHL) for my white labeled SaaS agency. The main objective of this page is to encourage users to sign up for a free trial. Essential requirements: * User data collection: Ensure our form collects Name, Email Address, and Phone number. * Design and branding: The layout must incorporate our company logo, precise color scheme, and our specific font style to deliver a consistent brand image. Ideal traits of the freelancer: * Proven experience in landing page design with a focus on conversion optimization. * Familiarity with Go High Level (GHL) platform. * Strong understanding of UI/UX principles. * Excellent attention to detail ensuring seamless integration of our brandin...
As an entrepreneur looking to expand my digital footprint, I need a team of programming experts proficient in Python, Java, and C++. Your task will be two-fold: 1. Web Application Development: Design and develop a web application from scratch, taking care of the UI/UX design, back-end functionality, and ensuring smooth user navigation on the platform. 2. Mobile App Development...mobile app, compatible with both Android and iOS. Ideal applicants should have previous experience in web and mobile app development and a solid understanding of the specified programming languages. Collaborative team players and those with a knack for problem-solving will be given priority. We value open communication so be prepared to participate in regular meetings and updates. Let's bring this proje...
Good morning, The mission is to finalize the app 'Z-anatomy' () () and to set up a functional webviewer linked to a database from it. This project is open source and non-commercial; it aims to provide the first open source 3D atlas of gross anatomy online and to let me update it in the future autonomously (I'm a blender 3D modeller specialized in anatomy). Due to the non-commercial nature of the project, the budget is 500 euros; the details can be negociated. Responsibilities Fix language/definitions bug, Create a function to handle exceptions of children staying visible, Show the bonus collections in the first popup window, Add the possibility to modify size and side of the lateral windows, Create an URL-based
I seek an expert in company registration to help set up my finance company. This company will be involved in both lending and providing loan services. Your Proficiencies: - Deep understanding of company registration particularly for finance companies - Experience in setting up businesses with focus in lending and financing Please provide relevant examples of your work and share how you can support us in this endeavor. The candidate should be able to guide us in all the legalities and paperwork involved in the process.
As an Arduino and Python developer, I'm looking for expertise to create a comprehensive flowchart that outlines the logic and working of an existing Arduino and python code. This is an essential task to me because I want to understand the sequential order of operations, from start to end. Main Focus: - Emphasizing the relationship of different features coded, and their flow from start to completion. - As one knows, the different parts of the Arduino code work together in achieving specific output, hence, a skilled understanding of the code's hierarchy is of great relevance. Ideal candidate: - Proficiency in Arduino and Python language. - Strong experience in flowchart development. - Ability to analyze complex scripts and map process flows. - Detail-oriented and t...
I'm in need of an experienced .NET/Angular developer who can build me an e-commerce website. Your task will primarily involve: - Creating a User registration and login system. - Establishing Product search and filtering capabilities. - Implementing a Shopping cart and checkout system. Moreover, it's essential for the website to support different payment methods. These should include: - Credit/Debit cards - PayPal - Bank Transfers This project will require someone with a proven track record in developing responsive and user-friendly e-commerce websites. Knowledge of .NET API and Angular are non-negotiable. If you have these skills and can complete this project ASAP, please get in touch.