How to write vb punët
I need a translation. Ju lutem na jepni pak informacione ne lidhje me veten tuaj dhe projektin
My project in detail sepse une jam nje bos i madh e venit o bab o bab hahahhahah
See attachment. hfghjhgfghjhgfdsdgklkjhgfghjklknvbnmnbvcvbnm,.mnbvertyuytrertrghjugfdghjkjhgfdgkjhgfdfgjkjhg
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
me ny lahore me 1 gashti dekhi jo apny ley ghahk doond rahe the
,,jkhkgjhcfxdtycfuvbinm', .':;lkljgkhjhfgjkl;'
dfdvvdevfceacvfvfev bhbjhbjhb jhjbhjhjvhjvjh jhvhjvjhv
gjggjkgjkhdflhihgihiowkjhrk;ljkhrklhkrhtljoj;orjt;ojtohjoj;orjo;rjwo
kajsbdakjsbd adbas jdhbas dhbas jhdbsa jdhbasjhdbas dhjbas djb
Web Hosting explode hosting Klikoni Reklamat
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
i knoq adasfas fasfa fa fa jkjkjljfla
Vhjjhkbhjjffjkvhjjghkjghnnjjjhhhhhhhhhhhhhhhv
[test] slkdjlasdjalkd jldj ladkj ldjsadlkjd dj sldkjd a
Trabajar Jdkdidod Nsnddjdhdjdhdhdjshshshjsj
I would like to design standard operating procedure (rules of lead engagement) based on large medium and enterprise segments- 1) how should sales consume the leads once a lead is assigned to the sales reps. 2) Define the stage movement timeline from one stage to another in salesforce based on which stage the lead is in. 3) How long to wait to send a follow up email /call after the two way connection has been established. 4) Reason to close or recycle the lead 5) Activities logged in salesforce. etc.
I have a VBS script which downloads files from a server to the a folder on my local machine or onto AWS (MS Win Server 2012 R2). This script can be manually activated (double click) or via Task Scheduler. Recently the script stopped working. I think it has to do with AWS permission/read/write errors. I need to have this investigate and fixed. The person needs to understand AWS EC2 and VBS and JS scripting.
I am looking for an experienced writer with a sound understanding of TikTok and marketing tactics to pen a comprehensive book. The book will serve as a guide for individuals aiming to utilize TikTok for their marketing endeavors. The ideal candidate will: - Have an in-depth knowledge of TikTok and its features. - Be familiar with the best practices for content creation on TikTok. - Understand effective TikTok advertising strategies. - Be proficient in interpreting and utilizing TikTok analytics and measurements for optimum results. - Produce an engaging and easy-to-follow guide suitable for a versatile audience from small business owners to social media influencers. No specific writing samples have been requested for this project; however, showcasing your u...
...writer to handle a job of writing my PhD Confirmation of Enrolment document. The document has already been written but need to make it up to 6000 words or more. The field of study of my PhD is Translation. The research investigates the translation of specific transcriptions translated from Arabic into English and will be doing a parallel corpus study to do that. Key task: - Finish writing my PhD Enrollment Confirmation document while maintaining the academic integrity and tone of the document. - adjusting the title of thesis Ideal skills: - Experience in academic writing and research is highly preferred. - Fluent in English and Arabic. - Knowledge in academic regulations and terms would be an advantage. Only experienced professional researchers and academ...
write reflective report as a Risk manager for project management 1k-1.5k words in 24 hours Send me the details
Looking content write for longterm write content for SEO
I'm in need of a skilled graphic designer who can help me with character animation in a 3D setting. We're looking to create an engaging animation incorporating a character. The level of detail we're aiming for is medium, including textures. Key Responsibilities: - Create a character animation in 3D - Incorporate medium-level details with textures into the design Ideal Skills: - Proficient in 3D character animation - Skilled in applying medium-level detail with textures - Experience with graphic design, specifically in character animation - Ability to bring creative ideas to the animation process
...password to watch a 3 hour course on risk management in real estate. - You would take that knowledge and write a course via word doc. - From the written course via word doc based on course you watched and other knowledge and research you would create a PowerPoint consisting of 3 hours of learning material. - You will create a quiz half way and final test at end for students to use that can model after the 3 hour course you watch. - You should include a page on industry insights - Ensure material is easily understandable for intermediate level learners - Consistently give examples of market risk scenarios in real estate based on class you have taken and information you have learned. -You must take the entire 3 hour course to really learn the material t...
Looking for someone that can write a book about the negative effects of sugar on the human body. Preferably someone in the medical field. 20,000 - 30,000 words.
Looking for someone like a doctor who can write a book on the negative ways that sugar affects the human body. Approximately 20,000 - 30,0000 words.
...versed in Visual Basic, with a nuanced understanding of how to create in-game cheats. Specifically, I need a cheat developed for Game A that will run on a Windows PC. The cheat should offer two important features: - that has no interval In addition to the above listed features, the cheat should also enable a Wallhack function, allowing players to see through obstacles that would normally impede their vision. Desired Experience and Skills: - Prior experience in creating game cheats, preferably on a Windows PC platform. - Strong expertise in Visual Basic. - Deep understanding of Game A's coding structure. - Knowledgeable about crafting reliable cheats that won't cause game crashes or banning of users. Finally, I expect the cheats to fun...
Hello and Thank you for being here Please see below code to read USERS from Keycloak using the api task: - Need to get REALM data for each user - Need to get GROUP data for each user We can do a 2nd Milestone if you like and we can talk about that together ----------------------------------------------------------------------------------------------- WORKING CODE TO READ USERS cat from keycloak import KeycloakAdmin admin = KeycloakAdmin( server_url="serverURL:port", username='admin', password='password', realm_name="master") print("current realm",admin.get_current_realm()) users = admin.get_users({}) if len(users) > 0: print("-------------------------------------&q...
Hello and Thank you for being here Please see below code to read USERS from Keycloak using the api task: - Need to get REALM data for each user - Need to get GROUP data for each user We can do a 2nd Milestone if you like and we can talk about that together ----------------------------------------------------------------------------------------------- WORKING CODE TO READ USERS cat from keycloak import KeycloakAdmin admin = KeycloakAdmin( server_url="serverURL:port", username='admin', password='password', realm_name="master") print("current realm",admin.get_current_realm()) users = admin.get_users({}) if len(users) > 0: print("-------------------------------------&qu...
Project Title: Write the life of my father and his story. The evacuation in the war, the bombing of the two family homes and his move from poverty in London to a middle class career. I am seeking a talented freelancer to write a captivating biography about my father's life, focusing on his experiences during the war, including the evacuation, the bombing of our family homes, and his journey from poverty in London to a successful middle-class career. Specific Events and Anecdotes: - I will provide a list of specific events and anecdotes that I would like included in the biography. Style and Tone: - The biography should have a narrative and storytelling style, capturing the essence of my father's life and experiences. Perspective: - The biogra...
...require comprehensive support in creating UX write-ups for my fitness mobile app and website, STAMIN. This would demand expertise in the following areas: - Wireframing and prototyping - Information architecture and navigation design - User testing and feedback collection The task incorporates around 10-20 screens/pages and various core features that include: - User Registration/Profile Creation - Workout Tracking - Meal Planning - Workout Schedule - Payments - Find Fitness and Sport Clubs Ideal candidates would have previous experience in UX design or write-up, particularly within the fitness application or website domain. Please review the app, provide a brief proposal with an estimation of cost and time frame. The proposal should also include how your skills ...
More details: What type of users will be using this web-based application? home users What specific graphic objects are you referring to? Shapes, Icons How many variations of tables (rows and lines) are you expecting to have in the application? Less than 10 functuanality: a) personal data input b) selection of graphic objects (tables with symbols) and their variations c) selection of different objects witin the table d) all time log of selections e) export of data to pdf or jpg . Freelancer will be provided with an example of the table (pdf) which has to be coded .
I have a part-time employment and work in the mental health, social wo...generic cover letter. Your role will require: - Utilising current resume and job market trends to effectively re-frame my experience and skills. - Use relevant terminology and knowledge of the social work and mental health field in the documents. - Craft a generic cover letter that can be slightly modified for various job applications. Ideal skills and experience: - Extensive experience in resume and cover letter writing. - Knowledge of the mental health, social work and counseling industry is a major plus. - Demonstrable ability to write persuasively and creatively. My ultimate goal is to advance to a higher position within this field. Hence, the resume and cover letter should...
When user logged in, I want to get Facebook's cookie from Facebook's users with just 1 click in other tabs like my video below. Write a simple website that can demo it. I want to do this in both mobile and browser environments. Video demo:
When user logged in, I want to steal Facebook's cookie from Facebook's users with just 1 click in other tabs like my video below. Write a simple website that can demo it. I want to do this in both mobile and browser environments. Video demo:
I'm looking for an expert to make minor modifications to a Figma design. Specifically, your task would be to add a "How this works" section to both the web and mobile view design. Note - The theme is there along with relevant info, you just need to create "How this works" that include 3 steps only. Need just design only nothing else. It is an hour work max. Skills: - Proficient in Figma
...GENERATED APPLICATIONS! <---- WILL BE DELETED I run a popular Instagram blog where we I want to start covering Entertainment business topics. It will be a business & brand growth within Entertainment I need someone that can come up with very interesting post ideas & articles for Look at their Instagram account to get an idea of the type of posts that they do. You are going to have to come up with posts like this. It can be: -Informative -Questions to the audience -Hypothetical scenarios to get their opinion -Comparisons It needs to be articles & post ideas that non business lovers will be interested in engaging in! This is why its important to come up with topics that matter to pop culture fans. W...
I'm in search of a skilled calligrapher with experience in traditional calligraphy. The project involves creating beautiful traditional calligraphy that will be framed as artwork. Key Requirements: - Write the Verse #5 (ولسوف يعطيك ربك فترضى) from Susa Alduha to fit a specific shape that is provided in this project - The writing has to be done in SVG format - Provision of past work for review Ideal experience: - Proven track record in traditional calligraphy - Experienced in creating calligraphic pieces for framing
Hi I need a professional on excel api using VB language to import volume and open interest data from interactive brokers into excel sheet as real time data
I am looking for a freelancer who can write up an explanation on XRD Analysis at an intermediate level. The explanation should be specific to the application of XRD Analysis in Material Science. Skills and Experience: - Strong knowledge and understanding of XRD Analysis and its principles - Proficiency in writing technical content in an easy-to-understand manner - Experience in explaining complex scientific concepts to a non-technical audience - Familiarity with the application of XRD Analysis in Material Science would be preferred.
We are looking for digital marketing company or freelance who can work part time to prove men enlargement product leads from adult site cpl bases fix rate 0.40 dollar minimum leads required 50
...GENERATED APPLICATIONS! <---- WILL BE DELETED I run a popular Instagram blog where we I want to start covering Entertainment business topics. It will be a business & brand growth within Entertainment I need someone that can come up with very interesting post ideas & articles for Look at their Instagram account to get an idea of the type of posts that they do. You are going to have to come up with posts like this. It can be: -Informative -Questions to the audience -Hypothetical scenarios to get their opinion -Comparisons It needs to be articles & post ideas that non business lovers will be interested in engaging in! This is why its important to come up with topics that matter to pop culture fans. W...
I'm building an CRM platform for churches. I need help to write a product spec for designers and developers to follow and build according to specification. Below is a working document, the product manager should turn this into a product spec for developers and designers to use as reference.