Include fade option windows player vb net punët
...this. I anticipate most of the sites would be pretty straightforward and am thinking that perhaps a monthly retainer would work best but perhaps if the cost per site was right we could work on that basis? I am also able to do some ground work in terms of layout and design, as in I could literally mock up sites in illustrator and then it would be just a matter of building them as is, if that is an option that would make our workflow more efficient. Things I would l need from the right person: 1. An eye for details. A lot of our communication towards the end of completion on each site would be in regards to small fine elements of the sites as I want the quality control of our output to be high. 2. Ideally I would like to work with someone who has ideas of ways we can make th...
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
I'm looking for a skilled Wordpress developer to create a sophisticated, user-friendly birthday invitation system. I need talent Wordpress can create system to manage all users created birthday invitions , I need to send my customer link . with some fields he need to choose from some options . example : name, age , address, every option have some drop list text he can choose for the format . and then after he finish . he click created order birthday . then I need approve this . after approve . he can share the invite birthday to friends and family . the design of the birthday page is full wide on screen. open only on mobile ! can't open on desktop . Can edit the invite birthday from admin . I want also later to connect this system to AIRTBALE if you kno...
I'm looking for someone to assist me in 3D rendering my house in a specific colour and make some other edits to the home in preparation for a renovation project. The changes need to include: - Extend the wall above garage doors by 80cm all the way around and insert planter boxes (if you can create one image with and without the plants falling across, see mock up option). - Insert balcony cover / roof across upstairs right glass door, in line with wall/roof on the legal, and to blend with house colour and render (include 1 rendered post on the right) - Align the garage doors so where both doors and the wall meet are aligned with the door to the right. - Remove window and door framing so they are flush to the walls - Colour changes to follow the colouring in ...
I'm looking for an experienced game developer to create a cross-platform open world game with a real...Requirements: - Development for PC, Xbox, PlayStation and Mobile platforms - Create a realistic open world experience - Ensure smooth cross-platform functionality The game should focus on the following elements: - Exploration: Detailed and immersive open world for players to discover - Combat: Engaging combat system that fits the realistic setting - Story-driven missions: Engrossing narrative that drives player engagement Ideal Skills: - Prior experience in developing open world games - Proficiency in multi-platform game development - Strong understanding of realistic game design - Ability to incorporate engaging gameplay mechanics Please provide examples of previous work i...
I'm looking for a talented web developer to redesign the layout of my website, bscyb.ch. The current site is built on .NET, but for this project I only need a new frontend design created with HTML/CSS/JS. Key Responsibilities: - Collaborate with me to implement an updated branding for the website - Create a responsive design that looks great on all devices - Incorporate interactive sliders into the layout to engage users - Develop customizable templates for different sections of the website Ideal Skills and Experience: - Proficiency in HTML, CSS, and JavaScript - Experience with branding updates and website redesign - Strong understanding of responsive design principles - Proven ability to create interactive elements like sliders - Excellent communication skills to collabora...
I am looking for a skilled individual to revise my R Easy Demand System. Although details weren't specified regarding the exact areas of the s...com/jpmam1/easi). I have cloned that package at It will be updated to become easi2. The easi package currently uses 3sls for the estimation stage. The revise version should have an option to choose either 3sls (the current method), or gmm (the method from the new script). 3. When the gmm option, allow an option to take additional covariates (instruments). The first step, is to make sure this script is working. Next, I am looking to add the script to this package: The package currently uses 3sls for the estimation, and want to add an option gmm based on the script I shared with you.
I'm in need of an experienced Flutter Developer who can design an application compatible with both Android and iOS platforms. Key features I'm looking to integrate are: - User Authentication - In-App Purchases At this stage, the requirements for SDK integration are open-ended as this question was skipped previously. Please recommend a suitable option you are comfortable with from the following choices: Firebase, AWS, Google Cloud, etc. Familiarity with Playstore submissions is also a must, ensuring a smooth transition from development to publishing. An ideal candidate for this role would have a solid record of creating Flutter applications for a variety of platforms, along with implementing the features listed above. Your techno-functional expertise would be crucial...
Hi, we need a c# .net/ maui package similar to with same functionality but with support for iOS in addition to existing platforms. Please don't ask for further details before you checked the package's page. Requirements: - the package must be able to Convert PDFs into images (save the whole pages to images, not just export existing images on pdf); - the package must provide iOS compatibility; - the package must provide a parameter to specify jpeg compression level and preserve colors; - the package must be developed in c#, compliant with .net/.net framework/Mono and ready to be used in windows/ maui ios & android projects; - the developer must provide c#, not hardcoded and fully commented source code;
I'm seeking an experienced modder to create a comprehensive Minecraft mod encompassing custom creatures, weapons, tools, and world generation. The key features include: 1. **New Creatures**: Mythical, Jurassic, and Alien creatures, with emphasis on mythical creatures. Particular mythical creatures include Dragons, Unicorns, Phoenixes, and even more such as Minotaurs, Gryphons, Hydras, Krakens, and many more from global folklore. A feature to turn creatures on and off is required. 2. **Custom Weapons and Tools**: Ranging from unique swords, bows, wands to hammers and more. Exceptional equipment from fiery axes, and immortal gems, to celestial bows are some of the expected creations. 3. **Improved World Generation**: I envisage unique dimensions including The Ethereal R...
I'm seeking a proficient C# developer, skilled in the .NET framework for a project. The exact application type is still to be confirmed. You should have: - Strong experience with C# programming. - Understanding of .NET framework. - Ability to work without strict time constraints. Time frames and further project details will be discussed upon connection. Looking forward to working with a focused and motivated professional.
...search of a qualified developer to create a sniper bot. This complex trading bot should ideally have the following features: -most important function is a sniper bot function with the ability to snipe the contract based on the wallet of the creator or a name used to deploy it. Example all the contracts that use the name PEPE will be bought instantly on presets values. and if i select the option to follow certain wallet will buy everything this wallet launches on - Automatic buy and sell orders: This bot should be able to place trades on my behalf, minimizing manual intervention. - Real-time blockchain analysis on the Solana network - Customizable alert system: I want to be alerted with all PNL data for every trade executed in real time after trade has completed. - Risk manag...
php 8.3 downloaded from . I require an expert in PHP installation and testing on my Windows 10 LAPTOP. I do not need Xampp or Wamp.
...search of a qualified developer to create a sniper bot. This complex trading bot should ideally have the following features: -most important function is a sniper bot function with the ability to snipe the contract based on the wallet of the creator or a name used to deploy it. Example all the contracts that use the name PEPE will be bought instantly on presets values. and if i select the option to follow certain wallet will buy everything this wallet launches on - Automatic buy and sell orders: This bot should be able to place trades on my behalf, minimizing manual intervention. - Real-time blockchain analysis on the Solana network - Customizable alert system: I want to be alerted with all PNL data for every trade executed in real time after trade has completed. - Risk manag...
Mail server is getting attacked, I need to create a windows service constantly checking a .txt log file for preset keywords like "Failed SMTP login" or "Relay attempt" to auto block IP's. This service should auto add/delete a new entry to a existing "inbound windows firewall rule" with the hacker's IP for a specific period of time. A good example or a similar concept could be found here: Some of the settings that I need to control: – Duration to ban ip address (min) – Number of failed login attempts before ban – Whitelist of comma separated ip addresses to never ban – Blacklist of comma separated ip addresses to always ban – Custom keywords, XPath and Regex to parse logs for failed login attempt...
We need a Social Media Specialist who can help me generate leads and sales for my windows and doors business through Facebook and Instagram. Key Responsibilities: - Develop and implement a social media strategy that aligns with our business goals. - Monitor and analyze social media KPIs to measure success. - Create engaging weekly posts and videos for Facebook and Instagram 2-3 per week, featuring premium products. - Develop interactive games to boost likes, shares, and engagement, offering gift vouchers and prizes. - Run targeted ad campaigns to increase brand visibility and drive sales. Requirements: - Proven experience in social media management, with a focus on Facebook and Instagram. - Strong content creation and ad campaign skills. - Ability to align strategies with brandin...
...put it together in a beautiful looking website. Logo and color theme is also final. The website will have following pages: Home Page Mobile App - we have a mobile app on google play store, we want to give complete information about the app, key features, faqs, pricing, direct user to google play store. We will be launching the iOS version shortly so the design must factor in both, with option to enable the iOS related content later on. Product Development Services About Us Blogs - this should use the CMS in framer Blog Articles The website must be responsive and work well on mobile also. You will have to complete the design on the framer project we will add you to, you will also have to provide images/illustrations/videos/any asset needed to complete the design with no lice...
About Us: We are the premier direct importer of pool heat pumps, offering unparalleled pricing directly to end customers. Through bulk purchasing and cutting out intermediaries, we provide the most competitive prices in the market. Our unique business model ensures that we stand alone in offering unbeatable value to pool owners across the country. Job Description: As an Exclusive P... • Passion for our products and dedication to promoting our unique value proposition. Benefits: • Lucrative commission structure with unlimited earning potential. • Comprehensive training and support to equip you with the knowledge and tools needed to succeed. • Opportunity to represent an industry-leading brand with a reputation for quality and innovation. • Flexible schedule and r...
Kami mencari programmer .NET dengan spesialisasi Blazor NET 8 dan diutamakan yang sudah familiar dengan Kendo UI dari Telerik. Di bayar berdasarkan satu project dengan term pembayaran sbb: Pembayaran 1: 20 persen (progress project 25%) Pembayaran 2: 25 persen (progress project 50%) Pembayaran 3: 20 persen (progress project 75%) Pembayaran 4: 25 persen (progress project 100%) Pembayaran Akhir: 10 persen (setelah UAT customer)
...not, it blocks other people to process reservation) Bank transfer option is delayed process, so it should get information by webhook from striper (until final confirmation, reservation shows still pending) 9. advanced reservation request if pay by card, same day (1 hour before their reservation start) reservation request is ok if client choose bank transfer opton, reservation request must be advanced for 3 days. if less than 3 days, it should show "can't process reservation with less than 3 days advanced request" and stop the payment process. 10. client doesn't choose sala number but only admin (backend) assign it 11. support spanish as main and English as option 11. pricing at least 2 different pricing option -simple 500 mxn per...
I'm seeking a skilled developer to create a simple naval war game. The game ...create a simple naval war game. The game will be played on a desktop platform and should allow for Player vs Player interaction. Ideal Skills and Experience: - Expertise in HTML and JavaScript game development - Experience with developing 2D games - Background in creating player vs player interactive games Key Requirements: - Game is to be playable on desktop platform only. - The game should be designed for player vs player interaction. A multiplayer format is not needed. - Design should be simplistic, incorporating plain 2D graphics only. By standing onboard this project, the chosen developer would be expected to bring our naval warfare game to life whil...
Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.
I'm looking for a computer engineer with strong expertise in Google technologies. Key Requirements: - Proficiency in Operating Systems and Technical Skills: You should be well-versed in various Operating Sy...tackle the challenges of the project. - Google Technology Proficiency: You must have a deep understanding and hands-on experience with Google technologies, products, and services. Ideal Skills and Experience: - Previous experience in software development, network security, or hardware design would be a plus. - Strong understanding and experience in using multiple operating systems, particularly Windows, Linux, and macOS. - Excellent problem-solving skills and the ability to work independently and in a team. - A proactive approach to learning and adapting to new technolo...
1) Implement MOSSE with SCRFD for Java Android 2) Implement it in our app by replacing MLKit and connect it to ...deliverables... implement MOSSE tracking with SCRFD for Java Android running the C++ libs. Create a demo app that runs detection and tracking and: 1. shows boxes and tracking ID for each face detected. 2. model size 3. fps 4. face confidence 5. screen resolution 6. Allow the app to run on Android's both front and back camera 7. add a zoom feature if supported by the device's camera. 8. add an option to upload and process recorded videos. no need to do ui/ux design key point is to integrate c++ library with android app Need to do some test before start Check SCRFD android repo on github, and build and run it first And then let me know
...The overall look and feel of the space should be elegant and classic. Key items is to find a way to design with being in a very limited budget,. need a welcome desk area need a seating area need an area that we need to use for photo of the bride purchased the gown. enhance current area for fittings. can move or build more dress hangers. using curtains as elements is an option using greenery and other plantery is an option. re location items is possible. need 3d rendering the pictures are in the order of entry to the store al the way back to the fitting area. Key Requirements: - The design should be luxurious and timeless, appealing to brides-to-be. - The layout needs to optimize the customer experience, considering factors such as privacy for fittings. - The interi...
I'm looking for a professional who can make a .jar file in Java 17 for me. It is intended to be a software product which I want to package and distribute. Here are the specifics: - Purpose: The main goal of this project is to create a .jar file that is user-friendly and easy to use for anyone who downloads it. - Platform: The .jar file should be compatible specifically with Windows operating systems. It should be tested and guaranteed to run smoothly on those systems. You should have: - Proficient in Java 17 and Eclipse. - Prior experience in creating .jar files for software products. - A good understanding of user experience and interface design to ensure the .jar file's usability. I'm open to suggestions on how to improve this project. Your creativity and expert...
I would like to creat door hangers two sided with this information Energy savings program “ Available in this zip code! Products include: Roof Tankless water heater Turf Electric panel upgrade Exterior paint Solar Windows Insulation HVAC Payment plans as low as $99 a month $0 money down Call today to get prequalified for programs and incentives available to homeowners only Representatives available for free assessment in your area call today to schedule appointment And make it in red colors that pop
...you create will save the Google search results in a .csv file. That is trivial and straightforward. The script(s) will also open the websites associated with the search results. That is also trivial and straightforward. The main challenge lies in locating and filling out contact forms on these websites with my first name, last name, email address, phone number, etc. Most search results will include a link to the company’s website. For example, when I search on Google for… Jake The Plumber Minneapolis, MN … I see a link to Jake The Plumber’s website. Your script(s) will not submit the forms; rather, I will review each form and then manually submit each myself. In other words, I will click on, for example, the “Send” or “Submit” ...
I am facing an issue on my Windows system where the internet disconnects every time I connect to my OpenVPN. This issue is significantly impacting my ability to work remotely and access the resources I need. Key Points: - The issue started occurring when I began using OpenVPN. - I work on my system and the VPN is a critical part of my workflow. - The problem is specific to my Windows operating system. I am looking for a professional who has: - Profound experience with troubleshooting VPN connection issues, especially with OpenVPN. - Strong knowledge of Windows operating system networking and its interaction with VPNs. - Excellent communication skills and can guide me through the troubleshooting process in a clear and understandable way.
I'm looking for an experienced developer to build a custom photo editor for my web application. This feature-rich editor should include: - A diverse range of filters for users to enhance their images. - Capabilities to allow cropping and resizing of images promptly and comfortably. - A user-friendly option to add creative text overlays. The photo editor should be compatible with both web and windows platform. The ideal freelancer will have strong experience in building custom features, particularly those involving image editing. Proficiency in a variety of programming languages, especially the ones that are most suitable for this type of project, is highly desirable.
I require an proficient developer to create a script that can send out automated emails through Gmail. This task should be accomplished with an app...Requirements: - Send out notification emails. - The notifications will be for scheduled reminders and service status updates. - Targeted audiences are all users and selected groups. Relevant skills include proficiency in JavaScript (as Gmail Scripts commonly employs this language) and familiarity with Gmail's API. Knowledge of handling scheduled tasks and interaction with user databases is also beneficial. In short, I'm looking for a coding and Gmail expert who can automate the process of sending important reminders and status updates to our users. The system should handle all users while also having the option to t...
I am looking for an expert in RFID technology and .NET programming to integrate the RFID into our current weighbridge system. Key Details: - 3rd Party System was developed using .NET and it does support API or external interface connections. - The task will involve programming to fully integrate the system with RFID technology. Skills and Experience: - Proficiency in .NET programming & SQL Database - Previous experience with RFID technology - Knowledge of API integration - Experience with weighbridge systems would be a huge advantage. Your role will be to ensure the smooth functioning of the weighbridge system post-integration and provide us with a user-friendly, effective RFID solution.
I am seeking a skilled developer fluent in Solidity to develop a web3 smart contract using the Base Sepolia Test Net. Your task will involve: - Developing web3 integration - Designing the simplest UI possible Ideal candidates should have previous experience with Ethereum blockchain technology, Solidity programming distinct to the Base Sepolia Test Net, and the creation of adaptable user interfaces. A background in web3 integration is highly desired. Please provide samples of smart contracts you've developed or relevant project references in your bid.
I'm looking for a skilled developer to help me with two main tasks, namely fetching data from a remote source and integrating a cryptocurrency payment option into my website. - Data Fetching: The fetched data, which will be in HTML format, should be displayed on a specific page of my site. Your task will be to use CURL to retrieve this content and have it dynamically updated on the website whenever the remote source updates. - Cryptocurrency Payment: I'd also like to have a cryptocurrency payment option incorporated into the site. The checkout should be seamless and intuitive for users, with the ability to complete transactions using popular cryptocurrencies. Ideal candidates for this project should have: - Proficiency in PHP and experience with CURL for data fe...
Exterior Front Porch Prepare Construction documents dimensioned and drawn on 36” x 24” paper 1. Plan View: A floor plan indicating the dimensions of the project, location of all walls, doors, windows, headers and beams (with sizes), structural members (such as floor joists, ceiling joists, and roof rafters including sizes, dimensions and direction), electrical outlets, electrical switches, lighting, smoke detectors, escape windows, appliances, electric service panels, bathrooms, furnaces, water heaters, all materials to be used, ceiling height, and all other pertinent information. If there is to be a fireplace, installation information must be submitted. 2. Cross Section: Show all materials to be used, basically a slice through the wall showing how the wall-ceili...
I have a VBS script which downloads files from a server to the a folder on my local machine or onto AWS (MS Win Server 2012 R2). This script can be manually activated (double click) or via Task Scheduler. Recently the script stopped working. I think it has to do with AWS permission/read/write errors. I need to have this investigate and fixed. The person needs to understand AWS EC2 and VBS and JS scripting.
Theme Home About us location Service Blogs (dynamic) Contact us Redesigning ofy website All content from this website as pages
I'm in need of a logo design. I want a stylish, sophisticated logo featuring a raven in an art deco style. The raven should be flying in a north-east direction. The design requirements are as follows: - The color scheme should predominantly be a mix of deep blue and black, with the option of using midnight blue as well. - The art deco style should be based on geometric shapes, symmetry, and abstract motifs. Please ensure that the design is sophisticated and not cartoonish or childish. - The font used in the logo should be simple and elegant. I have attached several examples of logos that I find visually appealing in this regard for reference. need to be in also in pdf, vector. Ideal Skills for this project: - Experience in designing art deco style logos - Proficiency in usi...
I need an expert windows application developer who can do automation
I'm in need of a versatile and comprehensive ERP system specifically tailored for a jewellery store. This system will need to be compatible with both Windows and Mac operating systems. Key Features: - Inventory Management: A robust tool to manage my stock of jewellery items, including tracking and updating inventory levels in real-time. - Sales and Order Management: A seamless system to handle the processing of orders and managing sales records effortlessly. - Customer Relationship Management (CRM): A centralized platform to store and manage customer information, with a focus on providing personalized and exceptional customer service. - POS & Credit Management: An integrated point of sale system that also incorporates credit management functionalities. - Finance Management...
I have four pictures of my parents that I would like to merge into a single photo frame design. The final design should be in black and white with a thin frame. The frame size should be 11 inches in height and 14 inches in width, and the photos should fade into the background from the shoulder upwards. Ideal skills and experience for this project include: - Graphic Design: Experience in creating custom photo frames is essential. - Photo Editing: Proficiency in black and white photo editing and blending photos seamlessly. - Understanding of visual composition and aesthetics. - Ability to work with specific dimensions and design requirements. Please submit your portfolio of similar projects if available. Looking forward to working with a talented and creative individual on th...
Help me publishing an Net6+ReactJs Project to IIS More details: Which version of Windows Server are you using for hosting the application? Windows Server 2012 Can you describe the specific problems or error messages you receive when attempting to deploy to IIS? SPA not launching when publishing to server folder: https//localhost:44321 works Have you ensured that the necessary files and dependencies for your React app are included in the published folder? Yes, I have checked and all necessary files are included
I need someone proficient in C# to help create a Remote Administration Tool (RAT). This tool will primarily offer remote desktop access. A user-friendly graphical user interface (GUI) is a must, with a clear and clean design that's simple to navigate. It should be tailored specifically for a Windows operating system. Ideal Skills: - Strong background in C# - Experience in creating GUI - Expertise in remote desktop functionalities Experience: - Developing RATs - Working with Windows OS - Designing intuitive GUIs
...with a touch of elegance. It should convey the brand's upscale yet accessible ethos. Inspirations: Please consider logos that are recognized for their clean, minimalistic lines but have a distinctive character. We admire the simplicity of logos like those of Tiffany & Co., Glossier, and Apple, which communicate their brands' essence at a glance. Additional Considerations: We would like the option to include a small, subtle emblem or motif that could stand alone or be integrated with the text. This could be a stylized version of a B or something that symbolizes beauty and youth. The logo should not only resonate with our direct customers but also be appealing enough to work in collaborative contexts, such as co-branded products or social media graphics. Deli...
...Looking to set up a chatbot that would guide a player through pre-determined story in messaging format. To enable world introduction and immersion, we want to set up chatbots in the style of "solo text RPGs", with characters actively engaging players to drive the storyline. We have scripts for several stories, featuring original characters, and are looking to set up chatbots that would allow these characters to proactively message the player and guide through the pre-determined plot, reaching a specific conclusion. Let's say a character is a player's roommate who forgot a book at home in a different town. The character proactively messages the player with descriptions of how to find a book and bring it to them. While on the way to the town, the ...
I'm looking for an experienced C++ developer to help me in developing new features for a desktop application. The application should be compatible with Windows OS. Key Responsibilities: - Develop new features for the existing desktop application - Write high-quality, efficient, and maintainable C++ code - Ensure the new features seamlessly integrate with the current application Ideal Skills and Experience: - Proficient in C++ programming language - Previous experience in developing desktop applications - Familiarity with Windows OS - Strong problem-solving and debugging skills - Ability to write efficient and clean code If you're a C++ developer with a keen eye for detail and a passion for creating top-notch desktop applications, I'd love to hear from you.
Requiero una API muy sencilla en .NET que reciba un objeto JSON con datos fiscales y retorne un ok, debe de tener OAuth 2.0, puede ser código tomado de internet el único requisito es que lo pueda ejecutar en mi equipo como localhost y hacer pruebas desde Postman