Make paging xml data vb net punët
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
YOUR BID IS FINAL. NO LATER CHANGE ALLOWED DO NOT BID WITHOUT SEEING THE ATTACHMENTS SEND YOUR SAMPLE VIDEO FIRST TO BE SELECTED I need someone to create videos on English Grammar on the topics given here in the attachment. It can be discussed in Chat. You should have a good, professional grade Mic. An electronic Pen is desirable. Topics for which you need to create the videos are Narration , voice change, parts of speech, sequence of tense, gerund, creating wh questions etc. Each topic should be minimum of 60 minutes length. You first need to explain the main concept, use examples and use some questions and then its answers with explanation.. also create 10 MCQ questions on each topic. Instructions to be in ENGLISH only. Use Screen recording Software and/or Whiteboard. VOICE MUST BE LOUD ...
I need a proficient PHP developer who can help me sign XML files and send them through SOAP using a .p12 certificate from FMNT in Spain. We need to use XMLDSig in the body of the message SOAP using: • Sign Algorith : RSA/DSA (better RSA - ) • Canonicalization: "exc-c14n" (Exclusive) • Digest Algorith : "sha1" ( - The certificate will be used on a web-based platform, which requires a professional with strong experience in working across different web environments. - The primary purpose of this project is to authenticate company data securely ensuring data integrity. - Ideal skills include a strong background in PHP, SOAP, XML, web security, and familiarity with .p12 certificates and FMNT standards
I need to create a script to consume a SOAP service with WSSecurity to Encrypt and Sign the XML, an example is the way SOAPUI is configured to consume the service. Preferably in Python, but the language is free. Necesito crear un script para consumir un servicio SOAP con WSSecurity para Encriptar y Firmar el XML, el ejemplo mas cercano que puedo dar es la forma en la que SOAPUI se configura para consumir el servicio. Preferiblemente que sea en python, pero el lenguaje es libre
...experienced .NET programmer to add a new feature to my existing application. Specifically, I need a modification to bypass member search by using a querystring. The page concerned is this:- We wish to have a direct url that replaces the process of searching for a member (eg member no 161068) and arrives at page two directly. For example, entering 161068 in the search box and selecting Checkedandvetted then pressing 'review this company' moves the user to page 2- review your experience. This is what we want to achieve with a single url. This is so that we can provide a url like that will do the same as the previous steps. Ideal skills for this job will include: - Strong knowledge of .NET programming
I'm in need of a Junior Full Stack Engineer who is proficient with Java, with beginner level experience. The primary task will be to work on implementing Go Live for an assigned project. Ideal skills for the job: - Understanding of Java programming language - Ability to work collaboratively on a team - JSON - XML - SQL - Data Mapping Some experience with project implementation is a plus. Dedicated beginners are also welcome to take their first steps in a real project.
...engaging, detailed biographies around net worth analysis. The articles will need to cover different individuals and their professional and personal journeys. Key requirements: - Ability to research and compile engaging biographical content - Experience in analyzing net worth, and presenting it in an accessible way - Strong writing skills, with the capacity to deliver both professional and personal tones - Quality sources to back up the net worth and biography analysis The ideal candidate will have a mix of a journalist's curiosity and a financial analyst's precision. This project will offer an opportunity to craft insightful pieces on successful individuals, and delve into the financial aspect of their lives. If you can combine storytelling with financi...
I'm looking for a functional implementation utilizing AWS media convert in a .NET core environment, with a specific focus on video transcoding. - Functionalities: The main functionality to be implemented is video transcoding with the target being MP4 format. - Desired Output: The desired output resolution for the transcoded videos should be 1080p. Ideal Skills and Experience: - Significant experience with AWS Media Convert - Proficient in .NET core programming - Experience with video transcoding technologies - Understanding of video formats, particularly MP4, and resolution settings.
I want a simple platform using APIs and web sockets to collect real time data and calculate the values and show in the form of heatmap using plotly heatmaps. I need 4 features. Liquidation heatmap, order book, net position heatmap and liquidation level. Please read attached requirements before sending a bid. And please quote actual amount
Integrated Al-Quran Education System Development Brief: Create a digital platform for Al-Quran education that features student progress tracking and transparent reporting. The system will utilize PHP Laravel, Flutter or .NET Core, with MySQL/MariaDB on a Linux server. Key Features: User registration for different roles: Admins, Teachers, Guardians, and Students. Payment options both online and offline. Attendance and performance monitoring tools. Video tutorials for Quranic concepts. Requirements: Experience in educational technology. Quick turnaround and budget adherence. Deliverables: Complete web application. User guide and maintenance support. Proposal Needs: Approach, timeline, and cost.
Seeking a highly skilled .Net Developer to upgrade the existing system's back-end, ensuring it's user-friendly and solid. Key requirements: - Enhance system navigation and ease of use. - Optimize system performance for heightened stability. - Bolster security features for increased protection. The revamped system should be able to integrate with current mobile applications seamlessly. While specific app functionalities have not been defined, the developer should have prior experience with real-time data synchronization, push notifications, and user authentication. In terms of project timeline, the expectation is for this to be completed within a month. Ideal Skills: - Extensive experience with .Net Development - Prior experience with system optimization ...
I'm seeking an experienced .NET developer with over 4 years of expertise in C# programming and SQL databases. Key Responsibilities: - Enhancing existing software application - Adding new functionalities The ideal candidate should possess: - Strong experience in C# programming - Solid knowledge and practical experience with SQL databases Be ready to dive into the project and help us bring significant functionality enhancements to our existing software. Your experience and skills in C# and SQL will be invaluable in this task.
I'm looking for a talented web developer to redesign the layout of my website, bscyb.ch. The current site is built on .NET, but for this project I only need a new frontend design created with HTML/CSS/JS. Key Responsibilities: - Collaborate with me to implement an updated branding for the website - Create a responsive design that looks great on all devices - Incorporate interactive sliders into the layout to engage users - Develop customizable templates for different sections of the website Ideal Skills and Experience: - Proficiency in HTML, CSS, and JavaScript - Experience with branding updates and website redesign - Strong understanding of responsive design principles - Proven ability to create interactive elements like sliders - Excellent communication skills to collabora...
Hi, we need a c# .net/ maui package similar to with same functionality but with support for iOS in addition to existing platforms. Please don't ask for further details before you checked the package's page. Requirements: - the package must be able to Convert PDFs into images (save the whole pages to images, not just export existing images on pdf); - the package must provide iOS compatibility; - the package must provide a parameter to specify jpeg compression level and preserve colors; - the package must be developed in c#, compliant with .net/.net framework/Mono and ready to be used in windows/ maui ios & android projects; - the developer must provide c#, not hardcoded and fully commented source code;
I'm seeking a proficient C# developer, skilled in the .NET framework for a project. The exact application type is still to be confirmed. You should have: - Strong experience with C# programming. - Understanding of .NET framework. - Ability to work without strict time constraints. Time frames and further project details will be discussed upon connection. Looking forward to working with a focused and motivated professional.
...optimization: Developing a backlink strategy and managing outreach to increase the website's visibility and authority. - Configuration: Implementing critical aspects of SEO configuration such as the permalink structure, XML sitemap, and file. The ideal candidate for this role should have: - Extensive experience with SEO in a WordPress environment - Proven track record in increasing website traffic and improving search engine ranking - Strong understanding of user engagement strategies - Expertise in configuring WordPress SEO components like the permalink structure, XML sitemap, and file. I look forward to receiving proposals from freelancers who can deliver tangible results in optimizing my WordPress website for search engines and user engagement. WHEN YOU C...
Kami mencari programmer .NET dengan spesialisasi Blazor NET 8 dan diutamakan yang sudah familiar dengan Kendo UI dari Telerik. Di bayar berdasarkan satu project dengan term pembayaran sbb: Pembayaran 1: 20 persen (progress project 25%) Pembayaran 2: 25 persen (progress project 50%) Pembayaran 3: 20 persen (progress project 75%) Pembayaran 4: 25 persen (progress project 100%) Pembayaran Akhir: 10 persen (setelah UAT customer)
I am looking for an expert in RFID technology and .NET programming to integrate the RFID into our current weighbridge system. Key Details: - 3rd Party System was developed using .NET and it does support API or external interface connections. - The task will involve programming to fully integrate the system with RFID technology. Skills and Experience: - Proficiency in .NET programming & SQL Database - Previous experience with RFID technology - Knowledge of API integration - Experience with weighbridge systems would be a huge advantage. Your role will be to ensure the smooth functioning of the weighbridge system post-integration and provide us with a user-friendly, effective RFID solution.
I am seeking a skilled developer fluent in Solidity to develop a web3 smart contract using the Base Sepolia Test Net. Your task will involve: - Developing web3 integration - Designing the simplest UI possible Ideal candidates should have previous experience with Ethereum blockchain technology, Solidity programming distinct to the Base Sepolia Test Net, and the creation of adaptable user interfaces. A background in web3 integration is highly desired. Please provide samples of smart contracts you've developed or relevant project references in your bid.
how to decode : All report content comes from the json data we provide, I explain the logic details in report logic.pdf., please check its content. I also attached a json data and a tire report , they come from one scan, you check its content to verify the report logic. we have to make similar script to generate report from our system
Need to fill area around the logo with creative wacy vectors lines or any creative suggestion, NO BIRDS
Requiero una API muy sencilla en .NET que reciba un objeto JSON con datos fiscales y retorne un ok, debe de tener OAuth 2.0, puede ser código tomado de internet el único requisito es que lo pueda ejecutar en mi equipo como localhost y hacer pruebas desde Postman
Hi STALLIONi NET SOLUTIONS, I noticed your profile and would like to offer you my project. We can discuss any details over chat.
We are looking to build a new website using WordPress which will link to our .net bespoke erp software which is currently being developed. As all our business is B2B, it’s very important for our customers to access as much information as they can online without the need to call our office. Features include: - Ordering products should be in grids for our customers to order - Customers to order embroidered/printed goods with product selection controls in place - Modern and attractive up-to-date designs - Customers should be able to view all their account information - Customers should be able to download copy invoices and credit notes - Customer should be able to pay online - Customers should see what’s on backorder for them including editing and cancel them - Livestoc...
Make a nice design for a lighting company's product catalog 2 products on each page with a small description of the product Like this:
I'm seeking a knowledgeable professional proficient in Azure Databricks, Azure Data Factory, and ADLS to assist with data manipulation and transformation tasks. In specific, you will be working with semi-structured data, particularly JSON and XML formats. Key tasks will include: - Filtering and cleaning of data - Converting the cleaned data into different formats Having previous experience with semi-structured data and being familiar with machine learning and AI integration will be highly regarded. I'm looking for an individual who can ensure efficiency and accuracy throughout the process. Let's make data work for us!
New simple Sans font using Fontstruct or similar. I have letter designs on paper. Will be an art font so not a large budget. It made me put Graphic Design & PS on here, I only want a font making to TT or whatever, I have designs
I'm seeking a skilled dot net developer to focus on major web development tasks. The core responsibility of the project will be functionality and programming. Key Tasks: - Implement a user registration system - Develop a shopping cart system - Convert existing PHP scripts to Dot net. Ideal Skills and Experience: A deep understanding of Dot Net, is a must, along with substantial experience in web development, specifically in functionality and programming. Proficiency in both PHP and Dot Net, specifically converting scripts from one to the other, is critical. Finally, hands-on experience with user registration and shopping cart systems is a significant plus. Don't hesitate to send me a message if you have any questions. Let's create somethin...
...Form Builder application that will be compatible with both web and mobile. Technologies: .NET 8 Blazor Server (web) + .NET MAUI Blazor Hybrid (mobile). MudBlazor (component library) JSON The application should have a builder component and a runner component. The timeline for the project is within a month. Here are some of the functionalities that are required in the form builder section of the application: - Capability to add various types of fields including but not limited to: * Text fields * Multiple-choice questions * Date fields * Dropdown fields * Free text fields - Ability to add a feature to take photos and store them locally. Freelancer Experience. Blazor Server (targeting web) .NET MAUI Blazor Hybrid (targeting Windows and Android) The idea...
...Developer, Oracle SQL Developer, Eclipse. The project involves writing comprehensive tests for a range of technologies including: - Java and JavaScript. - Spring Framework. - Oracle Database. - XML and JSON. - Junit. - Eclipse/Intellij. - PL-SQL Developer. - Utilizing Github and other version control tools. The ideal candidate must have a deep understanding and practical experience with these technologies. The project has an urgent timeline, so the selected candidate must be able to work under pressure and deliver high-quality results quickly. Ideal Skills: - Proficient in Java, Spring Framework, Oracle, XML, JSON, Junit, and JavaScript. - Experienced with Eclipse/Intellij, PL-SQL Developer, and Oracle SQL Developer. - Skilled in writing tests for Java and Oracle. - Fa...
...that hinges on the daily NAV (Net Asset Value) of the assets. The system should have the following key features: - **Tiered Commission Structure:** The system must support a 4-tier commission structure. These tiers should be clearly defined and adjustable by an administrator. - **Daily NAV Calculation:** The daily NAV should be calculated based on historical data. This data should be accurate and reliable, and the calculations should be precise. - **Automation:** The system should automatically trigger commission calculations at the end of each business day. This ensures that the process is efficient and error-free. The ideal freelancer for this project should have: - Proficiency in designing and developing commission systems - Advanced skills in historical ...
...on the page). It should be possible to delete and download invoices, both individual documents and all at once. * There are 2 fields created on the site (tariff payment and number of contacts). You need to make sure that these fields are also displayed in the mobile version of the site and add statement generation for these fields. * Set up the generation of a report (pdf file, form will be provided), which displays information about which users did not pay the bills of the previous month * On the 1st day of each month, files must be generated in Excel and XML-Format with the bank data entered by the contractor during registration and the amount to be paid from the account. One file for all users (form will be provided). * Fix the code when sending an E-Mail to ...
I'm in need of a skillful developer experienced in OpenCart 3.0.x who can work on a TNT extension for me, with an emphasis on two key features: 1. Real-Time Shippi...your online store or internal system. Please have this email directed to whomever controls the online portal: You are currently using the ASP version of the RTT service, and we need customers to move to our .NET version. This will require that the XML payload is URL encrypted, note there is no change to the content of the XML just how it is presented. I have included the newer spec doc but it should be a simple process. endquote I am at a loss on how to update or replace this extension. The links in the email take me to a blank page. The attachment is confusing, but you might be able to make ...
Finding Someone Who can Solve this error (One site is sending me callbacks and in 10 callbacks theyre getting this response in 5 callbacks and rest 5 callbacks are working fine) <?xml version='1.0' ?> <env:Envelope xmlns:env=''> <env:Body> <env:Fault> <faultcode>env:Client</faultcode> <faultstring>Internal Error</faultstring> </env:Fault> </env:Body> </env:Envelope
I'm searching for a proficient .NET developer to design and build an MRZ scanning plugin for Windows utilizing the device camera. The plugin must be able to handle the following documents: - Passports - ID Cards - Emirates ID Card (National ID of United Arab Emirates) No specific MRZ scanning library is currently preferred, so I welcome any suggestions. Ideal skills and experience for the job: - Proficiency in .NET language - Experience working with MRZ scanning plugins - Familiarity with different types of ID documents - Ability to integrate this plugin into Windows systems successfully - Experience with device camera utilization - Strong understanding of MRZ data extraction I am anticipating a product that efficiently captures the MRZ data from the a...
Freelancer capable of editing a PDF file in English and make a new file max 2 pages. The pdf should look aesthetically neat
I need to create a console project in C# Net Framework that I can listen the data from an equipment Mindray BC-20s and / or BC-30s. Using Ethernet configuration and HL7. The data that comes from the clinical equipment needs to be save it on txt file. The configuration is using TCP/IP and I need - Port for every equipment Any questions? I made a console project but I could no be able to get the results from those equipments. I need a person who had been working with HL7.
Título del proyecto: Aplicación de registro digital de parte de anestesia Descripción: Se requiere una aplicación móvil multiplataforma desarrollada en .NET MAUI que permita el registro digital de un parte de anestesia. La aplicación debe ser capaz de conectarse a una cámara a través de Bluetooth o Wi-Fi para tomar fotos cada cierto intervalo de tiempo (por defecto, cada 3 minutos) y utilizar OCR o IA para interpretar y obtener los signos vitales del paciente (frecuencia cardíaca, saturación de oxígeno, tensión arterial, etc.) a partir de las fotos tomadas. La aplicación deberá generar un gráfico de línea de tiempo donde se representen los signos vitales en el eje Y y la...
YOUR BID IS FINAL. NO LATER CHANGE ALLOWED DO NOT BID WITHOUT SEEING THE ATTACHMENTS SEND YOUR SAMPLE VIDEO FIRST TO BE SELECTED I need someone to create videos on English Grammar on the topics given here in the attachment. It can be discussed in Chat. You should have a good, professional grade Mic. An electronic Pen is desirable. Topics for which you need to create the videos are Narration , voice change, parts of speech, sequence of tense, gerund, creating wh questions etc. Each topic should be minimum of 60 minutes length. You first need to explain the main concept, use examples and use some questions and then its answers with explanation.. also create 10 MCQ questions on each topic. Instructions to be in ENGLISH only. Use Screen recording Software and/or Whiteboard. VOICE MUST BE LOUD ...
I am working with GridCore library from .NET Core. I am having issues getting the column headers to be displayed with the filters added. Now, I am only able to display the column headers titles. I need someone that has proven experience using this library and can give me the solution.
I am looking for prooven track profesional to manage and improve mi dropshipping store in health&wellnes,cosmetics store,EU and SUA market trending&winning products,content writing,ads campaigns set up will be 50% of net income, of sales.
Hello! I am looking for a skilled photographer to capture beautiful pictures for me. Type of Pictures: - Landscape - Portraits - Still Life Location: - I have a specific location in mind - I prefer a certain type of landscape - I am open to any location/landscape Number of Pictures: - 1-5 - 6-10 - More than 10 Ideal Skills and Experience: - Proven experience in landscape, portrait, and still life photography - Ability to capture the beauty of nature and people - Creative eye for composition and lighting - Proficiency in using professional photography equipment - Strong attention to detail and ability to capture the right moments If you are passionate about photography and can create stunning pictures, please reach out to me. I am excited to work with you to capture ...
Hola Necesito una API web muy sencilla en .NET únicamente que reciba un JSON con datos fiscales y utilice OAuth 2.0 debo de ser capaz de correrlo en mi equipo como localhost y hacer pruebas desde postman
I'm in need of a .NET developer with varied experience on the framework. The project requires multiple functionalities such as database integration, user authentication, and third-party API integration. Your application should demonstrate your past work in .NET, as well as your experience in the field. Please provide a detailed project proposal to give an idea of how you plan to approach this project. If you're well-versed in the .NET Framework 4.0, 4.5 or 4.8, this could be a great opportunity for you.
Usamos una aplicación web propia para previsualizar e imprimir facturas, pero nos gustaría poder descargar las facturas a formato FACe en .xml . Para poder enviarlas de forma electrónica a través de Nos gustaría desarrollar el módulo completo para que se puedan mandar las facturas firmadas electrónicamente y a organismos públicos.
We need a professional press release to announce a new...Middle East organisation based in Egypt. The target audience will be potential investors and distribution through various media outlets in both regions. Key Requirements: - The press release will need to contain background information mainly on the Canadian company and emphasize the finacial benefits of the partnership in a compelling manner. - The tone needs to be engaging and tailored to a high net worth individuals and financial professionals operating mainly throughout the middle east region. Ideal Skills: - Proven experience in writing press releases for finance industry. - Understanding of Middle East culture. - Arabic language a great asset - Strong copywriting skills and ability to convey complex ideas in a conci...
