Online vb.net project work punët

Filtër

Kërkimet e mia të fundit
Filtro sipas:
Buxheti
deri në
deri në
deri në
Lloji
Aftёsitё
Gjuhët
    Shteti i punës
    2,000 online vb.net project work punët e gjetura, me çmimin EUR
    €427 Oferta mesatare
    53 ofertat
    Build an Online Store Ka përfunduar left

    Kjo Osht Websitja me E Re Ne Ballkan <3

    €20 (Avg Bid)
    €20 Oferta mesatare
    5 ofertat
    Do some Excel Work Ka përfunduar left

    Jam i gatshëm për të bërë gjithçka që punohet me Microsoft Office Excel...

    €101 (Avg Bid)
    €101 Oferta mesatare
    9 ofertat
    Programing Ka përfunduar left

    Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc

    €11346 (Avg Bid)
    €11346 Oferta mesatare
    4 ofertat
    Crie um Website Ka përfunduar left

    Desenvolvedor .NET MVC, SQL e ADVPL Protheus

    €2755 (Avg Bid)
    €2755 Oferta mesatare
    1 ofertat
    Build an Online Store Ka përfunduar left

    multi vendor online ecommerce website

    €118 (Avg Bid)
    €118 Oferta mesatare
    12 ofertat
    Build an Online Store Ka përfunduar left

    adversting a beatyfull babies for blue eyes

    €523 (Avg Bid)
    €523 Oferta mesatare
    24 ofertat
    Build an Online Store Ka përfunduar left

    online multivendor ecommerce site

    €2301 (Avg Bid)
    €2301 Oferta mesatare
    3 ofertat
    Do some Excel Work Ka përfunduar left

    hello sir mujhe job ki bhut zaroorat hai plz aap se request hai

    €104 (Avg Bid)
    €104 Oferta mesatare
    4 ofertat
    qefqreqweqawdafsc Ka përfunduar left

    asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr

    €186 (Avg Bid)
    €186 Oferta mesatare
    1 ofertat
    Do some Excel Work Ka përfunduar left

    data entry kjhjkgkiugag jhgkugsdakfu sdfkjhjksg jfgjks jkgsfjkga sdfkjdg kjfhkj kjh jhf kfjhjn khk kjgugkn kjtgkjh jhtgiubh kjtguib tui ktiatu kjgijfuyt awefb kjguiasf kjghujf kjyuiyafn fuhiuyhfe flhkifdas ioyhuysdfn uiyuitydfn nawveen iujna jynarkujmar kumar kumar hjfhghghghgjhgjhgjhgjhgh

    €145 (Avg Bid)
    €145 Oferta mesatare
    1 ofertat
    Build an Online Store Ka përfunduar left

    hi cmvhkz zfjzkljfkldg adlgjladuglad glad ga

    €7 - €17
    €7 - €17
    0 ofertat
    Do some Excel Work Ka përfunduar left

    ass ccv cbc cvc mmn gjghjj jgjhg jgjjkghjg

    €150 (Avg Bid)
    €150 Oferta mesatare
    2 ofertat
    Do some Excel Work Ka përfunduar left

    hrthrtehthtttfjirtjgiotjhthtihjitfklxmckfrgyt9jrlgmrlkhntih5hjfmsckfgt

    €1172 (Avg Bid)
    €1172 Oferta mesatare
    1 ofertat
    Do some Excel Work Ka përfunduar left

    ghbbhbhbbjnbmmn,bhgvfgvhjvhhbhbhbv

    €316 (Avg Bid)
    €316 Oferta mesatare
    1 ofertat
    Do some excel work again Ka përfunduar left

    Aklghgeklg'kgjrth;'hhj[hthihklgb[fg'gggh;f'hkgh'hnkgd;nlhndghnjhl;hhklghgfhhghhghhjgjhghjghjdfd'

    €19 - €19
    €19 - €19
    0 ofertat
    yveguwvcjnjnecbkhb Ka përfunduar left

    ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif

    €106 (Avg Bid)
    €106 Oferta mesatare
    1 ofertat
    moeny for work Ka përfunduar left

    php programm for mobile_ section android, java, ajasdasdasdkasjdlkajsdkljasdjaskdjaskld lkjasdjaskdjaslsjdlkasjdlkajdlkjadljasldjlaskjd lkjaslkdjaslkdjkalsjdklasjdkasjdklasjdlkasjldkjasd lkajsdlkasjd

    €141 (Avg Bid)
    €141 Oferta mesatare
    1 ofertat
    Data analytics work Ka përfunduar left

    dkjkhhjhcjqhjdhwjhjqwhjdhje qwhhdjwhejdhjewhdqhewhdhwejhdjewh hdhqejhdhedjhjehjdhejhdjejhj hhjhhhjhj

    €520 (Avg Bid)
    €520 Oferta mesatare
    1 ofertat
    Course work Ka përfunduar left

    Discuss me on me on me on me on me on me.

    €9 / hr (Avg Bid)
    €9 / hr Oferta mesatare
    1 ofertat
    online data entry jobs Ka përfunduar left

    hello sir kmknknjnjnjnjhbhjbjbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb

    €8 (Avg Bid)
    €8 Oferta mesatare
    1 ofertat
    On Going Work Ka përfunduar left

    jbjgjgughjgujgfygghfgyfjhfyjhfghjfhfgjhfgfhgdcygghdyfyyhfhjfhvhjghvcgfgcgffgxcvbc bnvcbncgbvcxfxfsfgxvbxcfvbxcvbxcvbxvbxvbxbvxvbxvxbvgfcghfc

    €141 (Avg Bid)
    €141 Oferta mesatare
    1 ofertat

    ...platforms with a high experience of UI/UX to build an MVP of an online course platform/marketplace. Our main objective is to connect course providers with learners. Main Features: - **Course Search & Discovery**: This feature is paramount for our MVP with a very modern and professional UI/UX. Users should be able to easily search for courses and discover options tailored to their interests. Webinars and worships are the main education products on the platfrom. Target Audience: - Our platform primarily caters to hobbyists looking to learn new subjects. Therefore, the UI/UX should be engaging, intuitive and accessible to users with varying technical competencies. Skills and Experience Required: - Experience in developing online marketplaces or platforms is key. - ...

    €13208 (Avg Bid)
    €13208 Oferta mesatare
    43 ofertat
    Selling online courses 6 ditë left
    VERIFIKUAR

    We need someone to sell our courses online, through LinkedIn. English proficiency is required. Full remote job

    €1022 (Avg Bid)
    €1022 Oferta mesatare
    15 ofertat

    Only FTP will be provided. Link 1 column with another table. and amend existing API only

    €96 (Avg Bid)
    €96 Oferta mesatare
    9 ofertat

    I am seeking a meticulous and detail-oriented freelancer for a data entry project. The chosen freelancer will be responsible for entering data onto an online platform. The key responsibilities include: - Enter data accurately and efficiently onto the specified online platform - Arrange data alphabetically The ideal candidate should have: - Proficiency in data entry and data organization - Outstanding attention to detail - Ability to organize data alphabetically - Strong familiarity with online platforms This position is ideal for someone who has a good understanding of data entry onto online platforms and can organize information alphabetically. Your attention to detail and accuracy is paramount.

    €2 / hr (Avg Bid)
    €2 / hr Oferta mesatare
    36 ofertat

    I'm in need of an experienced individual to scrape data from the online gaming industry and compile a list of email contacts for companies outside the U.S. and preferrably in Cyprus Malta U.K. and LATAM Brazil Key Requirements: - Focus on the Online Gaming Industry: The primary focus of this data scraping project is the online gaming sector specifically. All data should be relevant to companies operating within this industry. - Company Contact Information: The main data that I'm seeking here are Marketing manager and Business development email contacts for companies within the online gaming sector. This could include CEO founder and other decision-makers within these companies. Skills and Expertise: - Proficient in Data Scraping: The ideal c...

    €9 (Avg Bid)
    I garantuar
    €9
    4 kandidaturat

    I am seeking a meticulous and detail-oriented freelancer for a data entry project. The chosen freelancer will be responsible for entering data onto an online platform. The key responsibilities include: - Enter data accurately and efficiently onto the specified online platform - Arrange data alphabetically The ideal candidate should have: - Proficiency in data entry and data organization - Outstanding attention to detail - Ability to organize data alphabetically - Strong familiarity with online platforms This position is ideal for someone who has a good understanding of data entry onto online platforms and can organize information alphabetically. Your attention to detail and accuracy is paramount.

    €4 / hr (Avg Bid)
    €4 / hr Oferta mesatare
    57 ofertat

    Do you know the SMIIRL Desktop counter? These "mechanic" counters are mostly used to display number of likes on Facebook, Instagram or TikTok. However they can be purchased in a "custom edition" where you should be able to monitor a lot of things like how many orders is in line in your online store. I need something so I can get a SMIIRL counter to display number of reviews my online store has on Trustpilot Im in contact with support at who are very helpfull. There are more options available with something called Zapier and JSON

    €34 (Avg Bid)
    €34 Oferta mesatare
    3 ofertat

    ...for a skilled online advertiser who can effectively leverage social media for my brand. The main goal of this campaign is to drive sales through generating orders. These orders should be processed through an online shopping cart. Key responsibilities: - Strategize and execute social media advertising campaigns to increase sales - Focus on generating orders through compelling advertisements - Ensure smooth processing of orders through our online shopping cart Skills and experience: - Proven track record of successful social media advertising campaigns, particularly in the area of driving sales - Expertise in using social media platforms for advertising, particularly for e-commerce - Familiarity with setting up and managing online shopping carts Your approac...

    €38 (Avg Bid)
    €38 Oferta mesatare
    15 ofertat

    Project Start Date 18 April 2024 Project End Date 18 May 2024 Working Domain : Your keywords + On page + 400 quality Google Indexed backlinks monthly + Technical SEO + GA and GSC setup and Fix the issues + 4 article for backlink submission + 4 blog every month + GMB optimization Target For 1st month: Backlinks: 400 backlink *) Should be on google Indexed *) Min DA PA 40+ *) 90% should be Do Follow *) 90% should be Uniqueue Domain Total Keywords: 19 have current Position N/A After 1 month (25% keywords should br in Google SRP ) Working Keywords: Online Cake Birthday cake Buy cake online Birthday cake online Flower online Cake shop near me order birthday cake online flower bouquet online flower delivery in delhi gifts...

    €168 (Avg Bid)
    €168 Oferta mesatare
    1 ofertat

    Enhancement for existing Java app. Who able to follow task shared onw by one.

    €143 (Avg Bid)
    €143 Oferta mesatare
    39 ofertat

    The company Metodo Toddler, company number 1 in Italy that sells English courses for Italians, is looking for a charismatic person to hold group lessons with more than 30 adults. Much better if you have experience in public speaking or experience in front of many people The candidate must necessarily KNOW ITALIAN, to communicate with the students and obviously have a HIGH LEVEL OF ENGLISH. Lessons are from 1 hour. If you think you are charismatic and can entertain more than 30 people to teach them English. We are waiting for you!

    €1501 (Avg Bid)
    €1501 Oferta mesatare
    2 ofertat

    ...talented web developers from India for a long-term collaboration. My project revolves around creating an informational website integrating a contact form and services section. The desired aesthetic is minimalistic and clean. Key Responsibilities: - Website development and design based on briefs - Implementation of a user-friendly services section - Inclusion of easy-to-use contact forms Ideal skills and qualifications: - Proven experience in website design - Strong aesthetic sense with a preference for clean, minimalist styles - Fluent in English, excellent communication skills Please mention your quote for a fully-functional website in your bid. Your creativity and problem-solving skills will be appreciated on this project, as well as your ability to build smart, user...

    €11 / hr (Avg Bid)
    €11 / hr Oferta mesatare
    52 ofertat

    ...MySQL, check voucher code in DB and return back, need to update order details in bottom of page (.js) and send email confirmations from Affiliate landing page order section. Need to implement online payment from Stripe on both order pages. First phase: 1. Login page (html done, some core PHP done) 2. Forgot password page (html done) 3. Sign up page (html done, some core PHP done - confirmation email needs work) 4. Orders list page (html done) 5. Single order page (html done) 8. Landing page Orders for Affiliates to share to friends (html done, some core PHP done - confirmation email needs work) 9. Backend dashboard (html done) a. Total sales for Affiliate b. Total Affiliates added by Affiliate c. Team bonus earned + link to team bonus page d....

    €516 (Avg Bid)
    €516 Oferta mesatare
    172 ofertat

    ...develop a 4-tier agency commission calculation system that hinges on the daily NAV (Net Asset Value) of the assets. The system should have the following key features: - **Tiered Commission Structure:** The system must support a 4-tier commission structure. These tiers should be clearly defined and adjustable by an administrator. - **Daily NAV Calculation:** The daily NAV should be calculated based on historical data. This data should be accurate and reliable, and the calculations should be precise. - **Automation:** The system should automatically trigger commission calculations at the end of each business day. This ensures that the process is efficient and error-free. The ideal freelancer for this project should have: - Proficiency in designing and developing commis...

    €109 (Avg Bid)
    €109 Oferta mesatare
    13 ofertat

    I am looking for flutterflow developer who knows flutter to work on an AI chat to get the streaming response and display the answer for every question like ChatGPT. ANd also relevant sources for each answer in the pdf viewer in the frontend. Project is half done in Flutterflow and the only work need to be done is getting streaming response from the backend and when source button is clicked needs to display/highlight the same in the pdf viewer. I will also be working alongside Budget: 100 dollars, timeframe 3 days, let me know if you are interested Specific features to include in the app: - Basic chat functionality to allow users to send and receive messages -implement PDFviewer system and highlight relevant chunks Design: - A design for the app is ready and will be ...

    €242 (Avg Bid)
    €242 Oferta mesatare
    9 ofertat
    Online Form Filler 6 ditë left
    VERIFIKUAR

    I am seeking a proficient freelancer to assist with completing online forms on my behalf. The task involves entering official resume data into the portals of various IT companies. Each form presents unique complexities, requiring the input of diverse official information tailored to the specific requirements of each company. Your role will encompass completing approximately 10-20 forms for IT companies within their designated hiring portals. This project demands precision and adherence to professional standards. If you possess the necessary skills and attention to detail for this assignment, I look forward to discussing further details with you. Thank you.

    €11 (Avg Bid)
    €11 Oferta mesatare
    47 ofertat

    I'm on the lookout for a talented virtual assistant who thrives on lengthy hours of work and enjoys every second of it! This isn't your usual VA role, though - I'm seeking someone who can confidently handle the following responsibilities: - Social Media Management: More specifically, I need someone adept at Instagram. You'll be responsible for handling and managing our page with finesse. - Content Creation: Creativity is the crux of this role. You're not just posting updates; you're creating content that resonates with our audience. Ideal Skills and Experience: - Clear understanding of the Instagram platform and how to optimally engage audience in it - Skills in crafting Instagram worthy content - visuals, captions, and stories - Experience in manag...

    €5 / hr (Avg Bid)
    €5 / hr Oferta mesatare
    45 ofertat

    I'm looking to open a personal account with a specific focus on online banking. Particular features I require include: - Mobile check deposits - Bill pay services - Money transfers Ideal candidates for this project should have ample experience working in personal banking and financial services. They should also have a thorough understanding of online banking features, such as mobile check deposits, bill pay services and money transfers. Having technical knowledge to effectively implement these services will be crucial to project execution.

    €7 - €17
    €7 - €17
    0 ofertat

    ...to venture into the e-commerce business with a focus on electronics, I am looking for a skilled developer to create a professional online store for me. Key Features: - The online store should be designed for selling a wide range of electronics products. - A crucial feature I'm aiming to include is customer reviews on product pages. I believe this will help in boosting consumer confidence and engagement. - The store should be integrated with a secure credit card payment system, ensuring a smooth and secure transaction process for my customers. Ideal Skills: - Proficiency in e-commerce website development and design, with prior experience in creating online stores. - Strong understanding of integrating customer review and payment features. - Knowledge of se...

    €152 (Avg Bid)
    €152 Oferta mesatare
    17 ofertat

    I'm seeking a professional to develop a top-notch mobile app. The main objective is not well-defined yet, but I'm open to discussing potential functionalities. Ideal Skills/Experience: - Proven experience in mobile app development - Ability to propose an...is not well-defined yet, but I'm open to discussing potential functionalities. Ideal Skills/Experience: - Proven experience in mobile app development - Ability to propose and implement diverse functionalities - Flexibility in terms of timeline as the completion date is not yet decided Your bid should include a brief description of your relevant experience, your suggested strategies for the project, and your availability for timely communication. Looking forward to hearing your ideas and creating an amazing mobi...

    €224 (Avg Bid)
    €224 Oferta mesatare
    7 ofertat

    I'm in need of a skillful developer experienced in OpenCart 3.0.x who can work on a TNT extension for me, with an emphasis on two key features: 1. Real-Time Shipping Rates: The extension should offer real-time shipping rates from TNT; it must consistently and accurately display current costs to customers. 2. Easy Installation and Setup: Ease of use is paramount. The extension should be straightforward to install and set up on my online store. The project deadline is within one month, so time management will be a crucial skill for interested freelancers. Proficiency with JavaScript, PHP, eCommerce, HTML and CSS is required, along with OpenCart experience. If you have worked on similar projects before, please include them in your proposal. This shopping cart has...

    €5 / hr (Avg Bid)
    €5 / hr Oferta mesatare
    11 ofertat

    I'm on the lookout for a talented video editor to help me transform raw footage into a polished promotional video. This project needs to be visually appealing and engaging, in line with a clean and professional editing style. NOTE: We will aim to provide you with raw footage tomorrow. We need this complete by 21st April (Sydney time) We will provide: script + base recording, copy overlays, graphics to go over the top It will be similar to these examples:

    €211 (Avg Bid)
    €211 Oferta mesatare
    40 ofertat

    I'm searching for a proficient .NET developer to design and build an MRZ scanning plugin for Windows utilizing the device camera. The plugin must be able to handle the following documents: - Passports - ID Cards - Emirates ID Card (National ID of United Arab Emirates) No specific MRZ scanning library is currently preferred, so I welcome any suggestions. Ideal skills and experience for the job: - Proficiency in .NET language - Experience working with MRZ scanning plugins - Familiarity with different types of ID documents - Ability to integrate this plugin into Windows systems successfully - Experience with device camera utilization - Strong understanding of MRZ data extraction I am anticipating a product that efficiently captures the MRZ data from the aforementioned ...

    €500 (Avg Bid)
    €500 Oferta mesatare
    35 ofertat

    I'm in need of someone with proficient typing skills and a keen eye for detail. The task involves filling online forms with basic personal information. Upon completion, these forms will need to be submitted via email. This is a meticulous task requiring accuracy and attention to detail. The ideal freelancer must have: - Skills in efficient and accurate data entry. - Strong proficiency in managing and organizing emails. - Great attention to detail. - Ability to maintain confidentiality. Expectations for the job: - Fill out online forms with provided information. - Submit these forms via email. - Ensure data privacy and integrity during this process. Thank you in advance for your attention to this task.

    €10 / hr (Avg Bid)
    €10 / hr Oferta mesatare
    63 ofertat

    Slider work with api connectivity. Full project code handover.

    €121 (Avg Bid)
    €121 Oferta mesatare
    1 ofertat

    Copy the value of drop down to another, and show in page only

    €12 (Avg Bid)
    €12 Oferta mesatare
    33 ofertat

    You need to connect to my anydesk, and fix some minor laravel stuff. If you are a auto bid, write autobid in the text so i can filter u away from my bids.

    €47 (Avg Bid)
    €47 Oferta mesatare
    43 ofertat

    Description: We are a psychiatric practice currently seeking a dedicated SEO specialist to join our team on a freelance basis. Our goal is to enhance our online visibility and authority in the mental health field. We have an ongoing on-page SEO strategy in place, but we require additional support to improve our off-page SEO. Responsibilities: Develop and implement a robust backlink strategy to increase the number and quality of inbound links to our website. Improve our website's domain authority and overall search engine rankings. Continuously analyze and report on SEO performance and adjust strategies as necessary. Collaborate with our existing SEO team to align on-page and off-page strategies. Recommend and execute improvements for optimizing SEO reach. Requirements: Prov...

    €5 / hr (Avg Bid)
    €5 / hr Oferta mesatare
    102 ofertat