Overview project hospital management system based vb punët

...via a new website targeting Russia, Ukraine, Belarus and EU Baltic states such as Estonia, Latvia and Lithuania. We are seeking a dynamic eCommerce Manager to assure success again. Location: For training purposes, preferably (and initially) the ideal candidate should be based close to Tallinn, but this can be discussed. However, once the manager is onboard and has gained enough confidence and experience, we are flexible, so, provided one could assure a good quality of service, this could also be a remote office based position in one of the target countries listed above. Employment type: Full time, with an 3 months trial period Main language skills required: mother tongue proficiency in Russian, good knowledge of English for internal communication. Other langu...

asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr

ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif

nhjkmbjkgugyufyufykjkhiu kiuy7yubnbjhggggghutyurrtr lbhrffyyffdfhbjjhgyfgjkgggnjhjvdrtstghjgszzxfvhjjhgjhjjsrdfjpooouiuyui

nhjkmbjkgugyufyufykjkhiu kiuy7yubnbjhggggghutyurrtr lbhrffyyffdfhbjjhgyfgjkgggnjhjvdrtstghjgszzxfvhjjhgjhjjsrdfjpooouiuyui

gdgkiuukgklgkjdgkgdhgghsgjkhfejfghjksdbjidshbkfjlndjhkjdnfkjdghuifnbjklfhdisjnfjdhfihjhejhkdlnfjdnfljkrhfiujnlknduiherionfgioehfienmihsdlkfmdkfukdmkduyfkdntdghifjhrjgbiodghjkfnfgjidhjifnrjkovhdjignjrkhfijrngjrghjrbguierygfiu5ntguiryfiorngurehgoirghurehngjkrhguiorhntiorhg8rntgjkfhguoitngijigmtighujtihgmtigujrijtgsopjdfigkjfiogbujtrikgjfiobvjhkrgjmndiohgkrmngkofjhgkotmngkjlfyotjrngjmdgifuhbdkjfhgdgjkdfhjkdhfjshgjerhyuiotyheruyhudjnmd,nvuidfy984yhoen huifyhry9erhfjhdughrgtnr hyeouifyhr tyry rguy ru grtiorhfgir ng r tr u9r fr f9ryurohfdghdfkjhffdjhrwhiorhrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrr hrjlklllllllllllqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeee...

I am in need of an expert Power BI developer who can help me integrate AI features into my existing project. Specifically, I'm looking to incorporate Natural Language Processing, Machine Learning Models, and Predictive Analytics functionalities. Key Requirements: - Proven experience in implementing AI features in Power BI is a must. - Strong background in Natural Language Processing, Machine Learning Models, and Predictive Analytics. - Proficient in working with SQL databases and Online APIs for data integration. - Ability to deliver a dashboard with basic filtering and sorting capabilities. Your main tasks will include: - Integrating the AI functionalities into the Power BI project. - Ensuring seamless communication between Power BI and the SQL databases, Online APIs....

I'm in need of a writer who's proficient in corporate finance to create a concise paper focusing on the fundamental concepts in this domain. The audience for this paper will be graduate students, so the content should be engaging and informative for individuals familiar with the field. Key requirements: - Create an overview of key corporate finance concepts: I'm looking for a paper that covers the primary theories and principles that underlie corporate finance, but in a way that's accessible and easy to understand for graduate students. - Target the graduate level: While the paper should provide a comprehensive understanding of the subject, it should avoid delving into unnecessary complexity. The ideal writer will be able to strike a balance between thoroughness...

As an experienced WP specialist, I am looking for a skilled consultant to help with a project regarding my website. I have Google Analytics installed on my WordPress site, but I want to rebuild it to better focus on tracking website traffic. I would also like to integrate a Consent Management Platform (CMP) via Google Site Kit to ensure I'm compliant with various privacy regulations. Key tasks may include: - Rebuilding Google Analytics to focus on tracking website traffic - Integrating a Consent Management Platform (CMP) via Google Site Kit Ideal skills for this project include: - Strong understanding of Google Analytics - Expertise in WordPress - Experience with integrating and configuring a CMP - Proficiency in setting up Event tracking in Google Anal...

I'm looking for a passionate, experienced co-founder with a diversely skilled design background to join me in building a strong brand in the Health and Wellness sector. Key Responsibilities: - Incorporating bold, vibr...create an engaging online presence - Co-developing and managing the brand's visual identity and ensuring consistency across all channels Ideal Candidate: - Extensive experience in graphic design, UI design, and web design - Proven track record in designing for modern and minimalistic brands - Previous experience in the Health and Wellness industry is a plus, but not mandatory - Strong brand management skills If you're a creative thinker with a keen eye for detail and a passion for Health & Wellness, I'd love to hear from you. Let's wor...

Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.

I am in need of a custom HR Applicant Tracking System with key features including applicant tracking, interview scheduling, and a complete onboarding process. Ideal candidates will have experience in: - Developing HR software with a focus on applicant tracking - Implementing features such as interview scheduling and onboarding - Understanding of workflows and fields customization - Creating user-friendly systems for HR managers The system should be easy to use while meeting the needs of HR professionals. Please consider adding in your proposal any relevant experience you have in this field. Thank you.

...in need of a proficient WordPress developer who can carry out effective content management for my website. Specifically, my website primarily features written blog posts. Your primary tasks would include: - Managing less than 10 pages or blog posts on a regular basis. - Updating the blog posts as necessary to create dynamic and attractive content. Ideal Skills and Experience: - In-depth understanding of WordPress and content management. - Proven experience working with written blog content management. - Exceptional attention to detail, ensuring cohesiveness and effectiveness in content presentation. - Excellent time management skills to ensure regular updates. This project center around content management, with keenness on frequency and ...

...in researching, identifying, developing and responding to Ontario/Canadian grant opportunities in areas that support IT, Digital Marketing & SEO programs. Essential Functions * Understand the history, structure, objectives, programs and financial needs of our organization. * Research grant opportunities from Ontario/Canadian government agencies. * Draft grant proposals and supporting documents based on the funding requirements of the organization. * Submit proposals to grant coordinators for approval. * Respond to internal and external queries on drafted and submitted proposals. * Maintain positive relationships with fund providers and other stakeholders. * Maintain records and submit reports related to grant opportunities. * Researches and identifies new Canadian Governmen...

Project Title: "Customer Order Management System" for an online retail business in MS Access. Objective: To develop a comprehensive database system that allows for efficient tracking and management of customer orders, inventory, and shipping. Key Features: 1. Customer Management - Store customer information including name, address, email, and phone number. - Track customer order history. - Customer feedback and preferences. 2. Inventory Management - Maintain a detailed list of products, including product ID, name, description, quantity in stock, and reorder levels. - Automated alerts for low stock levels. 3. Order Management - Enable creation of new orders with customer information, order details (product,...

I'm seeking a skilled marketing professional to construct a comprehensive investment offering. This is projected to facilitate the acquisition of an apartment complex in the next 3 months. **We will collaborate on the financial projections, specific business plan, etc. - we nee...contain: - Detailed information on the property and a projection on the returns - A thorough market analysis and a disclosure of potential investment risk - A succinct summary of the investment opportunity, a sponsor bio/track record, and a well-laid business strategy for acquisition and management Ideal candidates should have prowess in marketing and real estate acquisitions. Familiarity with multi-family property investments will be advantageous. Thanks in advance for taking the time to conside...

I'm in need of a schema markup expert with a high level of proficiency to implement necessary markup for my water treatment business - uswater. The project involves targeting approximately 60-70 cities for 5 different water treatment services. The website I'm working on is built on WordPress. Key Details: - I require schema markup for 5 different water treatment services, namely water filtration, water softening, water purification, legionella testing & management. - The focus is on 60-70 cities, although the range may widen based on the most cost-effective approach. Ideal Skills & Experience: - Proficiency in implementing schema markup, particularly for local SEO purposes. - Extensive experience with WordPress, as the website is built on this platf...

I'm in a hurry to develop a photo editor that includes filters, crop and rotate features, and the capacity to adjust brightness and contrast. The product must support JPEG, PNG, and GIF file formats. Since I'm l...rotate features, and the capacity to adjust brightness and contrast. The product must support JPEG, PNG, and GIF file formats. Since I'm looking to launch this as soon as possible, I need a developer who can jump right in and get moving quickly. Ideal skills for this project include experience in graphic design, coding, and knowledge in image processing and digital image file formats. A solid understanding of user interface design will also be beneficial to create a user-friendly photo editor. Pay attention to detail and time management skills are par...

I'm looking for a ghostwriter to create a comprehensive guide to intermittent fasting. The book will be in the form of an audiobook, specifically tailored for beginners eager to explore this dietary lifestyle. Requirements: - The book must be expertly written, engaging, and suitable for audiobook consumption. - It should provide a clear, simple, and detailed overview of what intermittent fasting is, its benefits, and how to get started. - I'd like the book to include personal success stories, showcasing various individuals' experiences with intermittent fasting. These stories should add depth, relatability, and motivation to the content. Ideal Skills: - Prior experience in ghostwriting, especially for health, wellness, or nutrition-related content. - Understanding...

...successful social media advertising campaigns is a must. - Analytics and Insights: The ability to monitor and analyze the performance of our social media efforts, and use these insights to improve our strategy, is vital. The ultimate goal of this training program is to increase our brand awareness across these three platforms. Ideal Skills and Experience: - Proven track record in social media management and training - Strong understanding of Facebook, Instagram and YouTube algorithms and best practices - Experience in creating and executing successful social media advertising campaigns - Proficiency in analyzing social media data and using it to inform strategy - Excellent communication and training delivery skills, with the ability to engage and educate a variety of team memb...

...full-stack software developer. The task at hand involves improving an already existing project with freshly integrated functionalities. An overview of the project's main requirements include: * Integrating the application with Stripe for online payment * Creating Telegram and WhatsApp bots (API) * Incorporating existing text into the translation module of React The primary aim of this project is to facilitate effortless yet functional implementation. Also, the urgency of the tasks varies, with the addition of existing text to the translation module of React taking top priority. Your experience with APIs, Stripe integration, and React translation modules will be key to the success of this project. The project will take place in a controlled envi...

I'm on the lookout for a skilled Flutter developer to create a cross-platform (iOS and Android) restaurant application with intuitive and us...categories and individual meal descriptions. - Online Ordering: Requisite infrastructure for placing orders online, including a secure payment process system. - Reservation System: Must include a highly-efficient table reservation system with instant confirmation. Ideal Skill set: - Extensive knowledge and experience with Flutter app development - Strong fluency in Dart programming language - Proficiency in implementing secure online payment gateways - Previous experience with restaurant or similar e-commerce applications is a plus In your bid, please furnish samples of your previous work and estimated timeline for th...

I need an Android IPTV...variety of content for viewers. The panel should come with the following functionalities for user management: - User subscriptions management: allowing the administration of user accounts and subscriptions. - Multi-user access control: enabling different levels of access for various users. - User activity tracking: to monitor and analyze user engagement with the platform. Ideal candidates for this project should have experience in: - Developing Android applications, particularly in the field of IPTV. - Building user-friendly interfaces and ensuring smooth user experiences. - Implementing live streaming capabilities and managing video-on-demand libraries. - Creating web panels for user management with the specified functionalities. - Pr...

Java based app backend for tourism activities need 2 things. 1 - add a copy activity in activity page to copie a existing activity content to a new one 2 - migrate backend from vps centosOS to cpanel based hosting.

I'm seeking a professional able to create a custom CRM system in Excel for my business. Key requirements: - Sales Tracking: I need a system that allows me to monitor sales performance and forecast future sales. - Task Management: The CRM should have a task management feature to help me organize and prioritize my daily activities. Additional details: - The system will be used by a small team of 1-10 users, so it needs to be user-friendly and easy to navigate. - No integration with other software or platforms is needed at this time, so the focus will be solely on creating a robust, efficient Excel-based CRM. Ideal skills and experience for this job would include: - Proficiency in Excel, with a clear understanding of how to create complex form...

I'm seeking a skilled developer to build a trading bot for the Solana web3 infrastructure. This project involves: - Smart contract deployment - Token and wallet integration - Algorithmic trading bot development Your expertise should include proficiency in creating trading bots, with a deep understanding and prior experience in implementing auto-buy and sell features. Knowledge of trend following, mean reversion and breakout trading strategies is crucial for this role. Additionally, I expect familiarity with the Solana ecosystem to ensure seamless integration. Your input will be vital in positioning the bot precisely within the market dynamics.

We are seeking an experienced software developer to join our team and work on developing a secure and scalable VPN/Internet gateway solution. This project involves building server software capable of authenticating client connections and providing access to the internet. Requirements: Master's degree or PhD in Computer Science, Cybersecurity, or a related field Extensive experience in internet security, privacy, and VPN technologies Strong proficiency in server-side software development Familiarity with OpenWrt and router firmware development (preferred) Passion for internet security and privacy Responsibilities: Develop robust Wireguard exit nodes and VPN server software Ensure seamless integration with existing client software and VPN router firmware Implement secure authe...

I am in need of a skilled Django Developer to work with my team in my office in Delhi on a 4-week contract or less. Key responsibilities: - Collaborate on the development of a Django application - Implement and maintain a secure, efficient and scalable back-end - Integrate APIs as and when required Skills required: - Strong expertise in both back-end and database management - Proficiency in Django - Experience with secure and efficient code - Efficiency in API Integration and Django Rest Framework Please note that this position requires onsite presence in Delhi, so only those who can commit to this requirement should apply.

I would like to create a project similar to , which is an artificial intelligence platform for the visual analysis of documents, and integrate it with an attachment management system for an online bookstore.

I'm in need of a skilled professional who can assist me in entering cabinet estimates in Xactimate. I'm looking for someone with the following skills and experience: - Proficiency in Xactimate: It's crucial that you are well-versed in utilizing Xactimate software to create accurate estimates. - Understanding of Cabinet Costs: While I'm looking for a basic overview with general pricing, a clear understanding of cabinet costs is essential to ensure the estimate is accurate. - Strong Communication Skills: As we'll be working together via Zoom, I require someone who is comfortable with video and audio communication. During our session, you'll be responsible for guiding me through the process of entering cabinet estimates on Xactimate. Your expertise will ...

I recently switched to a new web developer and am in need of guidance on transferring my entire store data from old Woo Commerce account to the new one. Key Tasks: - Directing me on how to transfer all the store data (products, orders, customers) from my old Woo Commerce account to the new one. - Advising on the best practices to ensure a smooth tra...disruptions to my business. Ideal Skills and Experience: - Proficient in Woo Commerce and e-commerce data transfer. - Excellent communication skills to guide me through the process clearly and effectively. - Proven experience in similar accounts transfer projects. Your role will be purely advisory and instructional, as I will be handling the actual data transfer myself. Please provide a brief overview of your relevant experience whe...

I'm looking for a skilled software developer who can create a custom, user-friendly test taking software for my extensive questio...strict and flexible time limits for each test. - The results should be displayed in a detailed breakdown by question. Ideal Skills and Experience: - Proficient in software development, specifically in creating educational software. - Experience with creating user-friendly interfaces and interactive features. - Strong understanding of database management to handle a large question bank. - Familiarity with constructing detailed result summaries based on user performance. Please provide examples of similar projects you've completed. I'm open to suggestions on how to make the software more efficient and effective for our users, s...

I'm looking for a skilled Python develope...securely gather logs from IoT devices. - Access Control Management: It should have the ability to manage and control access to the security system. Logging Mechanism: - The application should be able to log activities from sensors and smart home devices effectively. Ideal skills and experience: - Strong Python programming skills, coupled with experience in security applications. - Proficiency in designing and implementing robust intrusion detection systems. - Prior work on IoT device integration and data gathering. - Experience in access control management is a plus. - Understanding of secure logging mechanisms. In your bid, please include examples of similar projects you've completed and let me know how you pla...

...WooCommerce site is hosted on a VPS/Dedicated hosting package. I'm in need of a WooCommerce expert who has significant experience in performance optimization, handling high server loads, and reducing database query delays. The ideal candidate should have: - Proven experience in troubleshooting and improving WooCommerce site performance - Strong knowledge of server management, particularly VPS/Dedicated hosting - Expertise in database management and optimization - In-depth experience with caching plugins and techniques Please bid if you're capable of identifying the issues causing these performance problems and can provide robust solutions to enhance my WooCommerce site's speed and server performance....

Hello, We are looking for a talented and experienced design freelancer to create a template and logo for our online ERP system, under the name "SOLTETI". The template will be based on the existing layout of the following website: [Link to website: ] Project description: Goal: Develop a template and logo for our online ERP system, maintaining the visual identity and functionalities of the website layout provided above. Layout Details: The website layout provided will be made available to the selected freelancer for reference and inspiration. Technical requirements: The template must be compatible with our ERP system and easily integrated. It must follow best design and usability practices. Be responsive, ensuring a consistent experience...

As the client, I require a dynamic and engaging informational website catering to a general audience. Although I don't have a specific design style in mind, the site's l...feel should be appealing and user-friendly. Key Tasks: - Designing and iterating website. - Implementing user-friendly features and functionalities. - Monitoring and maintaining the site post-development. Ideal Skills: A freelancer with a broad range of web development skills will help achieve the best results. This includes proficiency in HTML/CSS, JavaScript, graphic design, and content management systems, among others. A strong sense of aesthetics and an understanding of user experience principles are also essential. Prior experience in developing informational websites for a general audience wo...

...on-page content for improved search engine visibility. • Utilize Linkwhisper (Paid) to strategically optimize internal linking structure and enhance topical authority for blog posts, ensuring content is displayed in a topical authority format on the blog page. • Monitor and analyze SEO performance metrics, making data-driven decisions to improve organic search rankings and traffic. 2. Plugin Management: • Audit existing plugins to identify redundant or outdated plugins that can be removed to streamline site performance and security. • Update and maintain necessary plugins, including 301 Redirect Pro and WP Rocket, to ensure compatibility and optimal functionality without conflicts. 3. Site Performance Optimization: • Implement caching, lazy loading, and o...

I am in need of someone with expertise in updating tasks in a digital planner. I would need the freelancer to: - Automate the initial task in bucket 1 to re-appear after completion - After bucket 1's task has been completed, automate a new task in bucket...planner. I would need the freelancer to: - Automate the initial task in bucket 1 to re-appear after completion - After bucket 1's task has been completed, automate a new task in bucket two, -Once bucket 2's task is complete, automate a new task in bucket 3, and so on. I specifically require these tasks to be automated using Power Automate. The ideal freelancer will have experience in digital task management, Power Automate and task automation. This should allow for a smooth update of tasks in my planner without t...

...ecommerce website development, a keen sense of corporate aesthetic, and a proven track record of integrating user management tools, search functionalities, and transaction processes. Honed skills in design, UX and ecommerce are essential for the success of this project. The site could have 17,000 members who would need to have profiles on the site, there would have to be membership levels, the site would sell merchandice and on-line coureses also charge for consultation on a timed basis. there would have to be upload and download capability for documents and images. it would be good if we could post to the social media account from the site. there would have to be a messaging system throughout the site (google workspace). Also a CRM as many messages to the site wil...

I am seeking an expert to help maximize sales for my private label of men's grooming products on Amazon. I am focused on growth and optimization, so your knowledge of Amazon's platform and proven track record in ...seeking an expert to help maximize sales for my private label of men's grooming products on Amazon. I am focused on growth and optimization, so your knowledge of Amazon's platform and proven track record in eCommerce will be crucial. Your responsibilities will include: - Setting up product listings - Marketing and advertising strategies - Knowledge of SEO strategies for Amazon - Inventory management Experience in the men's grooming sector is helpful, but not a necessity. Your knowledge of selling private labels and proven Amazon sales results ...

...exam portal web application. Key Features: - User Registration and Login: Implement a secure system to allow students to register, log in and access the platform. - Exam Creation and Management: Develop tools for examiners to create and manage exams. This should include the ability to set time limits, number of questions, and other relevant parameters. - Result Generation: Implement a function that will accurately calculate and display exam results to students. Additional Information: - The portal will only be supporting specific types of exams. - The ideal candidate should have experience with similar projects and be able to provide a secure, user-friendly and efficient solution. - The project requires an understanding of good UX/UI design for easy navigation an...

I am in need of an experienced expert to design a dehumidification system for my entire household. Energy efficiency, noise level, and capacity are critical factors for this design. Essential Skills and Experience: - Experience in Environmental Systems Design, specifically for dehumidification or similar indoor regulation systems - Familiarity with designing complex residential systems - Strong emphasis on energy-efficient design strategies - Understanding of noise level control within system design - Experience with different dehumidification system capacities Potential applicants are kindly asked to highlight their experience and give relevant examples of previous work.

I'm seeking a skilled graphic designer to create an icon-based logo for my company. The desired logo should meet the following criteria: - Style: The overall aesthetic should be casual, veering away from the rigid structure of formal styles. I'm interested in a more relaxed, amusing approach that embodies a cheerful spirit. - Color Scheme: Adorn the logo with bright and vibrant colors. These colors should bring the logo to life, making it more appealing and eye-catching to the audience. - Type: The logo should largely be icon-based, focusing more on imagery than text. Ideal Skills: - Graphic Design skills are necessary, notably in creating logos. - Familiarity with designing icon-based logos. - An ability to balance color, design aesthetics, and imagery eff...

I have a VBS script which downloads files from a server to the a folder on my local machine or onto AWS (MS Win Server 2012 R2). This script can be manually activated (double click) or via Task Scheduler. Recently the script stopped working. I think it has to do with AWS permission/read/write errors. I need to have this investigate and fixed. The person needs to understand AWS EC2 and VBS and JS scripting.

Project Budget: $100 Project Deadline: 1-2 Days Project Type: Custom WordPress Plugin Project Difficulty: Standard PHP Version: 8.2 and above Project Overview: Custom WordPress plugin required to allow a user to: - Upload a CSV with bulk new POST data - Select a post category, schedule start date, choose how many posts to PUBLISH each a day - Import post data and create all new posts as DRAFTS, to go live on the specified post schedule & keep a suitable log that can be checked - Insert the new POST IDs back into the original CSV file & automatically download the update CSV for a user 5* FEEDBACK WILL BE LEFT FOR YOU

Looking for an expert in Oracle Utility Application Framework (OUAF) technology who can assist me on a project urgently. Task Components: - Designing intuitive and efficient user interfaces. - Developing custom functionalities as per the project's requirements. - Implementing data integration for seamless information flow. While the main purpose behind this project hasn't been detailed out, the chosen tasks indicate it would greatly aid in streamlining processes or improving data management. Hence, the project might have leanings towards enhancing the efficiency of business operations. Ideal Candidate: - Proficient in designing UI for OUAF. - Track-record in performing custom functionality development. - Proven skills in implementing data inte...

...Score Cards SQL Server RDBMS SQL Server Analytics Services SSAS SQL Server Reporting Services SSRS Tableau Reporting BMC Control M Scheduler Tool Data Analysis Data Profiling Application Life Cycle Management Complete Testing process SDLC, Agile Process, SAFE and Kanban methodologies, TFS Tool Good Communication Skills and Quick Learner Selenium Automation Unix Finance Domain Knowledge Automation Scripting using excel Macros Other Functions: • The Quality Engineer IV participates in the development and implementation of procedures for maintaining and or enhancing the integrity of Santander-s system application • Ensuring the existence of development and service standards • Ensuring that requirements are clearly defined and testable • Responsible for the...

I'm in need of a skilled animator to create a 30-45-second whiteboard animation. The primary goal of the video is to convey educational content. No voice-over services are required, as I'm planning for it to be a non-verbal piece. Key Requirements: - Whiteboard Anim...as I'm planning for it to be a non-verbal piece. Key Requirements: - Whiteboard Animation: The ability to create engaging and informative whiteboard animations is a must. - Educational Content: Prior experience in creating educational videos or animations will be highly regarded. - Attention to Detail: I need someone who can ensure the animation is clear, concise and visually engaging. - Time Management: The video should be around 30-45 seconds, so the ability to work efficiently while still producing...

I need to create new functions in a system based on React.JS, Java Script

...designers, providing mentorship, guidance, and support to foster professional growth and development. - Set clear objectives, performance expectations, and priorities for the team, ensuring alignment with project goals and timelines. - Delegate tasks effectively, balancing workload and skill levels within the team to optimize productivity and quality of work. - Conduct regular performance evaluations, provide constructive feedback, and identify opportunities for skills enhancement. 2. UI Design: - Collaborate with product managers, UX designers, and development teams to understand project requirements, user needs, and business goals. - Translate wireframes, user flows, and design specifications into visually stunning and intuitive user interfaces for web and mobile ...