Receive send text messages online vb net punët
I need someone in Tirana to visit several shopping malls and send me some pictures and information. More info after I award the project. It will be one off visit, and not more than 10 pictures. Kam nevojë për dikë në Tiranë për të vizituar disa qendra tregtare dhe për të më dërguar disa fotografi dhe informata. Më shumë informacion pasi të jap çmimin e projektit. Do të jetë një vizitë dhe jo më shumë se 10 fotografi.
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
PLEASE CONTACT ME TO DISCUSS FURTHER
PLEASE CONTACT ME TO DISCUSS FURTHER
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
miredita shqipe pom duhet me qu shum emaila ndoshta munt te mundesh mem ndimuu te pershendes me tmira
hello sir kmknknjnjnjnjhbhjbjbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb
I am looking for assistance in creating a visually engaging, professional PowerPoint presentation, using a provided style template, based on a 64 double side page Word document. Key details: - Extract key points and messages to form a summarized version of the Word document's content. - Encompass a range of 50 to 80 slides with a balance between text and relevant images to ensure readability and viewer engagement. - Align with pre-existing PowerPoint template aesthetic. Ideal candidate should have: - Excellent summarization skills and attention to detail. - Proficiency in PowerPoint. - Experience in creating engaging corporate presentations. Presentation would need to be done in 5 days
...looking for a skilled developer to enhance the online appointment and payment system on my website. - **Current System**: We are currently using Fittlebug for our online appointment scheduling system. The new system will need to be compatible and integrated with this existing platform. - **Key Features**: We aim to incorporate the following features into the new system: - Real-time Availability: Customers should be able to see real-time availability and book accordingly. - Automatic Reminders: The system should automatically send reminders to customers before their appointment. - Payment Integration: The system should facilitate payment for appointments. - **Payment Integration Details**: Although we're considering integrating an online payment ...
... - Set up and manage a simple landing page with registration functionality. - Direct outreach to potential participants and manage registrations. - Provide weekly updates on recruitment progress. Skills Required: - Proven marketing experience, preferably in healthcare or social services. - Strong communication and organizational skills. - Ability to create basic marketing materials and manage online content. - Experience with direct outreach and engagement strategies. Compensation: - Flat fee of $500 for the project duration. - Performance-based bonus of 20% per registrant based on a $39 registration fee. Project Duration: - The total project is expected to last about 6-9 weeks, with active recruitment planned for approximately 4-6 weeks. Additional Notes: - The goal is to b...
I am seeking an entity with expertise in ESP32 programming, specifically having an in-depth understanding of RTKLIB's implementation and RTCM conversion. The task includes: - Coding, making the ESP32 project work in coordination with the RTKLIB to function optimally - RTCM (Radio Technical Commission for Maritime Services) code conversion is needed. Particularly converting RTCM messages 1005, 1077, 1087 to 1006, 1004, 1012 and adding 1033 - The ideal candidate for this project needs to be familiar with the RTK rtcm and how to utilize the 'TADJ = 1' variable in the RTKLIB to enhance positioning accuracy and aid in correcting transmission errors. If you have the skillset, including an understanding of sensor data processing and receiver clock adjustments, please a...
...last name, email address, phone number, etc. Most search results will include a link to the company’s website. For example, when I search on Google for… Jake The Plumber Minneapolis, MN … I see a link to Jake The Plumber’s website. Your script(s) will not submit the forms; rather, I will review each form and then manually submit each myself. In other words, I will click on, for example, the “Send” or “Submit” button. If I were to loop your script(s) X times, then your script(s) would open X tabs in Google Chrome. Each tab would contain a website for a particular business. For example, if I were to loop your script(s) 89 times, then your script(s) would open 89 tabs in Google Chrome. Each tab would contain a website for a part...
...organization raise funds to supply medical equipment to people in need in Israel (for starters). We are a USA charity, registered with the IRS. We have a website and payment portal ready. We also have initial marketing being carried out with The Times of Israel. Eventually, we will be expanding the scope of our service. We have suppliers and logistics for delivery of donated equipment. We have an online payment portal and are now ready for action. Your Present Role Involves: - Figuring out how to build momentum within the Jewish community, and with any other people or groups who have goodwill, who would be willing to help injured persons gain faster, better recovery with gifts of leading edge virtual reality rehabilitation systems. The initiative is called Project Mobili...
O sistema deverá conter dois ambientes sendo um de administrador, que tenha possibilidade de cadastrar clientes e criar perfis para cada clientes cadastrar seus crachás. Neste ambiente o adm irá criar campos de entrada de dados para cada cliente, ex: o cliente A tem um crachá com dados variáveis (nome, RG e data de nascimento) e o cliente B tem um crachá com 6 dados variáveis (nome, identificação interna, CPF, RG, data de entrada e carteira profissional). No segundo ambiente somente o cliente terá acesso para que ele faça os pedidos e anexe fotos de forma unitária (cada crachá será pedido unicamente por ter dados variáveis, mas poderá fazer parte de um pedido com 5 crachás...
...group chat client for me. The client will primarily be text-based, allowing group communication between multiple users. Key Features: - Group Chats: The primary function of this chat client is to facilitate group chats. Therefore, it should support multiple users in a single conversation thread. - User Mentions: I'm also looking for the implementation of user mentions, which will enable users to tag others in a message, signaling their attention. Additional Features: - File Sharing: The ability to share files within the chat would be a very useful feature. - Chat Moderation Tools: I'd like the chat to have basic moderation tools to oversee the group chats and manage user interactions. Ideal Skills and Experience: - Proficiency in text-based chat client devel...
I'm in search of a virtual receptionist who can handle incoming phone calls and take messages, then email me the information. Here are the details: - Main Responsibilities: You'll be primarily responsible for answering calls and taking messages. - Software Proficiency: You should be well-versed in operating phone system software efficiently. - Communication Skills: It's essential that you can convey messages accurately and professionally via email. - Schedule: April 25-26, 9am-5pm - USA Pacific Time Zone (Located in Nevada, USA)
Need the work to start right away with fast turnaround. Convert a pdf to a google doc so the text can be editable.
I'm in need of someone adept at PHP and SOAP. My development site is currently returning a warning message: "Attempt to read property "Invoice_Number" on string." I've set up a dev SOAP server for you to carry out the work. At this point, I'm uncertain if I'm attempting to access the "Invoice_Number" property on a string. There are also no other error messages accompanying this issue. Key tasks: - Identify the cause of the "Invoice_Number" warning - Fix the PHP SOAP warning Ideal skills: - Proficiency in PHP - Experience dealing with SOAP - Ability to troubleshoot and resolve such issues promptly
Seeking an experienced firmware engineer to create the firmware on an STM STA8089FG GNSS chip to customize the data sent out via its UART interfaces. The task: - Obtain firmware source code and SDK from ST - Modify firmware to allow custom UART data output: UART0 - GNSS, UART2 - debug strings - Provide source codes so we can update debug messages if needed
The database is on the National Environmental Agency's website, and it includes all of the applications submitted for environmental permits. Here is a link to the database: Please go over all of the records, and filter ones that match all criteria: 1. EIA Screening Application/Statement or EIA Scoping Application/Statement and 2. The application is for an activity in the sea Start a new spreadsheet, and for every such record, meeting the above criteria, add a row to the spreadsheet including: date of the record, screening/scoping, title of the application (translated to English), a url linking to the application on the NEA website. In addition, download the screening/scoping report document, translate it to English with Google translate, and provide it as well. Start the search f...
I want to set up an online shop on my website and have it connected to Fresha CRM, the system I currently use. This shop should have a sophisticated design that complements my brand image. Key Requirements: - Development of a product catalog with detailed descriptions and prices - Inclusion of a shopping cart and a seamless checkout experience - Integration of online ordering and payment functionalities - Payment gateway setup to accommodate credit card and bank transfer options - Customization to align with an elegant and sophisticated design style Ideal Skills and Experience: - Proficiency in e-commerce development and CRM integration - Strong portfolio of elegant and sophisticated web design projects - Previous experience with integrating payment gateways - Excellent un...
For this project, I am in need of a text-based logo that's designed in a minimalist style with a monochrome color scheme. Key Requirements: - Text-based design: I'm looking for a logo that primarily features the name of my brand or company. - Minimalist style: The logo should be simple, clean, and incorporate minimal design elements. - Monochrome color scheme: The logo should be designed in a single color, specifically in a monochromatic palette. Ideal Skills and Experience: - Proven experience in logo design: A strong portfolio of text-based logos is highly preferred. - Proficiency in minimalist design: Prior experience in creating visually appealing minimalist designs is a plus. - Understanding of monochrome color schemes: A solid grasp of working within...
I am looking for an expert in RFID technology and .NET programming to integrate the RFID into our current weighbridge system. Key Details: - 3rd Party System was developed using .NET and it does support API or external interface connections. - The task will involve programming to fully integrate the system with RFID technology. Skills and Experience: - Proficiency in .NET programming & SQL Database - Previous experience with RFID technology - Knowledge of API integration - Experience with weighbridge systems would be a huge advantage. Your role will be to ensure the smooth functioning of the weighbridge system post-integration and provide us with a user-friendly, effective RFID solution.
...for our Diploma programs as well as younger students 8 - 17 for part time teen & children programs. The Academy is a private Career College training in the field of film & television. Key Tasks: - Develop a targeted Google Ads campaign aimed specifically at young adults aged 18 to 25. - While creating ads, the main goal is to generate leads who will potentially enroll in our in person & online courses. - Advise on budget, ad copy, and design to ensure maximum engagement and lead conversion. Skills and Experience: - Proven experience in running targeted Google Ads campaigns. - Strong understanding of the education industry and what appeals to young adults. - Demonstrated success in lead generation through digital advertising. - Exceptional copywriting...
I am seeking a skilled developer fluent in Solidity to develop a web3 smart contract using the Base Sepolia Test Net. Your task will involve: - Developing web3 integration - Designing the simplest UI possible Ideal candidates should have previous experience with Ethereum blockchain technology, Solidity programming distinct to the Base Sepolia Test Net, and the creation of adaptable user interfaces. A background in web3 integration is highly desired. Please provide samples of smart contracts you've developed or relevant project references in your bid.
Hello, We are looking for a talented and experienced design freelancer to create a template and logo for our online ERP system, under the name "SOLTETI". The template will be based on the existing layout of the following website: [Link to website: ] Project description: Goal: Develop a template and logo for our online ERP system, maintaining the visual identity and functionalities of the website layout provided above. Layout Details: The website layout provided will be made available to the selected freelancer for reference and inspiration. Technical requirements: The template must be compatible with our ERP system and easily integrated. It must follow best design and usability practices. Be responsive, ensuring a consistent experience across different
I'm in need of basic architectural renderings for my online project consultancy. These will be used for client presentations specifically. Key Project Details: - **Type of Renderings**: Architectural - **Level of Detail**: Basic outlines and structures - **Intended Use**: Presentation to clients Ideal Freelancer: - Experience with architectural rendering - Skill in creating detailed yet simple visualizations - Understanding of client presentation needs in a digital setting I would appreciate if you could provide some relevant portfolio pieces with your bid.
I am seeking a talented website developer to construct a formal, corporate-style ecommerce platform for my business. This high-quality site should be designed with the following features: - User registration and login capability - Product search and filter ...there would have to be membership levels, the site would sell merchandice and on-line coureses also charge for consultation on a timed basis. there would have to be upload and download capability for documents and images. it would be good if we could post to the social media account from the site. there would have to be a messaging system throughout the site (google workspace). Also a CRM as many messages to the site will be inbound leads. There can be other suggestions for development. scalablity, desktop, phone and tablet ...
I have a VBS script which downloads files from a server to the a folder on my local machine or onto AWS (MS Win Server 2012 R2). This script can be manually activated (double click) or via Task Scheduler. Recently the script stopped working. I think it has to do with AWS permission/read/write errors. I need to have this investigate and fixed. The person needs to understand AWS EC2 and VBS and JS scripting.
I am in immediate need of a skilled AWS developer to address various issues in my application. These include improper error handling, server banner disclosure, and misconfigured CORS. Requirements: - Identify and rectify improper error handling, ensuring that user-friendly error messages are displayed and errors are logged for debugging purposes. - Address server banner disclosure, to enhance the security of the application. - Modify CORS configuration to prevent misconfigurations and enhance security measures. I am looking for an expert who is well-versed in AWS, particularly in working with applications. The ideal freelancer for this job should have: - A thorough understanding of AWS services and its integration with Next.js. - Proficiency in addressing security vulnerabili...
I'm in the process of starting a new enterprise and want to launch an online test series product. This product will be similar to a GMAT test series product, providing questions for the test series. I don't have a domain name or hosting yet, so I'm looking for a coder who can handle both the site development and the product launch. Key requirements include: - Setting up a website for the test series product - Moderate customization with some unique features. I'm looking for something that stands out but isn't overly complex or expensive to maintain Ideal skills and experience: - Proficiency in web development, particularly site launching and product integration. - Experience in creating and launching online test series products would be a significan...
I am a motivational speaker, and my objective is to create compelling video ads that effectively target professionals, entrepreneurs, and C-level executives. The main focus of these ads will be: - High-quality, engaging video content - Captivating messages that resonate with my target demographic - Strategies designed to generate more leads The ideal freelancer for this project should have: - Expertise in video ad creation and editing - Proven record in creating successful video ads - Excellent understanding of target market dynamics - Skills in lead generation Your innovative ideas will be invaluable in achieving my goal of expanding my influence and reach in the professional and entrepreneurial spheres.
...assist me in my university project on Nursing Education. - Your main task will be to conduct detailed online research on the subject. This includes but is not limited to: - Gathering data, reports, and academic studies regarding the latest methodologies in nursing education. - Identifying key trends, challenges, and opportunities in the nursing education field. - Exploring innovative teaching strategies and tools used in nursing education. - Your research should ultimately help me in developing a well-informed and comprehensive research paper on Nursing Education. Ideal Skills and Experience: - Proven experience in educational research or nursing education. - Familiarity with online research methodologies and academic databases. - Strong analytical and critical th...
Seeking skilled video editors with expertise in motion graphics (text animations, titles) for my educational or tutorial-themed Instagram reels. Your main tasks will revolve around giving a dynamic visual appeal to the videos, ensuring they're engaging and on-brand for the platform. Key Responsibilities: - Implementing text animations and titles to enhance educational content - Ensuring the videos are concise and well-paced, as they should be up to 15 seconds in length - Collaborating with me to understand the key messages and ensuring they are effectively communicated through the visual elements Ideal Skills and Experience: - Proficiency in video editing software, particularly with motion graphics capabilities - A portfolio demonstrating your experience with ed...
Hi Global Text Solutions, I noticed your profile and would like to offer you my project. We can discuss any details over chat.
Help me publishing an Net6+ReactJs Project to IIS More details: Which version of Windows Server are you using for hosting the application? Windows Server 2012 Can you describe the specific problems or error messages you receive when attempting to deploy to IIS? SPA not launching when publishing to server folder: https//localhost:44321 works Have you ensured that the necessary files and dependencies for your React app are included in the published folder? Yes, I have checked and all necessary files are included
I'm in need of a talented designer who can help me in creating a modern logo. This logo will play a key role in my branding efforts, primarily for online platforms. Key Points: - The logo should be modern in style, aligning with current design trends. - It should be versatile enough to be used effectively across various online platforms. - A strong portfolio, particularly with experience in branding and designing for web, is a must. - Basic familiarity with online marketing practices is a plus.
...chatbot that would guide a player through pre-determined story in messaging format. To enable world introduction and immersion, we want to set up chatbots in the style of "solo text RPGs", with characters actively engaging players to drive the storyline. We have scripts for several stories, featuring original characters, and are looking to set up chatbots that would allow these characters to proactively message the player and guide through the pre-determined plot, reaching a specific conclusion. Let's say a character is a player's roommate who forgot a book at home in a different town. The character proactively messages the player with descriptions of how to find a book and bring it to them. While on the way to the town, the player encounters more adve...
Requiero una API muy sencilla en .NET que reciba un objeto JSON con datos fiscales y retorne un ok, debe de tener OAuth 2.0, puede ser código tomado de internet el único requisito es que lo pueda ejecutar en mi equipo como localhost y hacer pruebas desde Postman
opencart site has error, need to fix that More details: What specific issue are you experiencing with your Opencart site? Error messages on the site Could you specify the nature of the error messages appearing on the site? Server related errors What kind of server-related errors are you experiencing? other
Are you an expert in WhatsApp marketing? We're looking for a professional to assist with sending daily marketing messages to our existing customer base. The ideal candidate should have experience in bulk message sending and a solid understanding of effective marketing strategies on WhatsApp. If you're skilled in crafting engaging content and driving customer engagement through messaging platforms, we'd love to hear from you.
