Show source code vb exe punët
ping me
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
Have you ever heard of TradingView? Do you know what PineScript is? Do you have experience with Javascript? Do ...know about website crawling techniques and extracting hidden/protected data? I have recently found a protected indicator on TradingView (written in PineScript) and I need your help to extract the source code. I have no idea if the task has been done in the past or not, but your job will be to find a way to do it. Only apply if you are confident you can think of at least one way to achieve it. One common approach might be going through the Chrome debugger and inspecting the Javascript code, but that may not be sufficient given it's a protected script. Payment will be done only after the source code has been extracted successfully and test...
Attention. Those who are ready should apply. People who only send requests should not apply. I am looking for a Cora PHP specialist who can add VIEWS code to the control panel. When the news articles are viewed by the users, it should be displayed in the control panel. Views should not be repeated, it should remember the user's ip address or device
...an Elixir developer well-versed in troubleshooting and correcting open source code, specifically for Mobilizon—an event planning platform. There's an immediate need to address bugs and errors affecting both the User Interface (UI) and functionality of the platform's features. Key areas that require attention: - Resolve UI issues tilted towards the incorrect computation of available seats for events - Address the affected functional features associated with UI errors See this link for details of bugs: (note that the project owners have quoted a 500 euro fee to fix this themselves, but this is excessively high for something that is small code fix.) Will provide SSH access to my instance of Mobilizon to troubleshoot
...of 3 days for this task. **Project Overview:** I have a PHP Laravel source code that includes a licensing program, and I am looking for a talented developer to remove the entire licensing mechanism. Once the licensing program is successfully removed, I expect the freelancer to hand over the complete source code. I can provide a hosting package for testing purposes, or the freelancer is welcome to use their own hosting account. **Deliverables:** 1. Removal of the licensing program from the source code. 2. Handover of the complete source code. 3. Testing on provided hosting or freelancer's own hosting account. **Additional Requirements:** I request detailed change logs documenting every modification made to the source ...
It is necessary solve some few errors that have my application. It is necessary experience in laravel coding. Please send me your experiences in complex coding not simple web). If you show me the experiences, I will send the details of changes
As an entrepreneur looking to expand my digital footprint, I need a team of programming experts proficient in Python, Java, and C++. Your task will be two-fold: 1. Web Application Development: Design and develop a web application from scratch, taking care of the UI/UX design, back-end functionality, and ensuring smooth user navigation on the platform. 2. Mobile App Development: Mirror the web application in the form of a fully functional mobile app, compatible with both Android and iOS. Ideal applicants should have previous experience in web and mobile app development and a solid understanding of the specified programming languages. Collaborative team players and those with a knack for problem-solving will be given priority. We value open communication so be prepared to participate in ...
(USA Position Only) Hey there! I'm Jaden, a freelance designer specializing in Tradeshow Graphic design. I prioritize client happiness above all else. With my workload reaching its limit, I'm seeking a junior designer to join me on this exciting journey. Are you an aspiring graphic designer ready to kickstart your career? Join me and dive into the world of Tradeshow Graphic design! I'm offering an opportunity for entry-level designers to grow alongside me, delivering top-notch designs and ensuring client satisfaction. Details: Pay: $15-25/hour Workload: 5-10 hours/week, with potential for more Perks: Bonuses for completed projects and potential for a long-term contract While experience is a plus, what's most important is your ability to understand a brief and meet d...
As an Arduino and Python developer, I'm looking for expertise to create a comprehensive flowchart that outlines the logic and working of an existing Arduino and python code. This is an essential task to me because I want to understand the sequential order of operations, from start to end. Main Focus: - Emphasizing the relationship of different features coded, and their flow from start to completion. - As one knows, the different parts of the Arduino code work together in achieving specific output, hence, a skilled understanding of the code's hierarchy is of great relevance. Ideal candidate: - Proficiency in Arduino and Python language. - Strong experience in flowchart development. - Ability to analyze complex scripts and map process flows. - Detail-oriented and t...
Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.
Javascript code to escape Instagram embedded browser to Safari on iOS, automatically redirect
Upgrade my flutter project , SDKs and convert my flutter code to a working null safety code / project using your own technical abilities and COPILOT ( mandatory) .
ISO of expert coder who can debug a scheduling app for a vendor market built in on Vercel using Typescript, MongoDB, Stripe API, Sendgrid, Cloudinary, etc. Looking for success where others have failed to deliver. Not rocket science, but fairly involved proprietary app.
I'm searching for a competent PHP developer who can assist me in modifying some Code Canyon scripts. I did not specify which scripts for this project, giving you the flexibility to apply based on your wide-ranging experience in PHP script modification. Main Task: • Modify various Code Canyon PHP scripts as per requirement. The ideal freelancer for this job should have: Relevant Experience: • A strong track record of modifying PHP Scripts, preferably but not limited to, CodeCanyon scripts. Your application will stand out if you share specific examples of your previous work in this area. • Experience in a related industry would be a bonus. In your application kindly focus on your: • Experience with PHP and script modification. This project could l...
I need a professional with experience in Shopify custom liquid coding. The objective of this project is to create three custom liquid codes based on samples I will provide. With this, my website's performance will improve. Ideal Skills: - Proficiency in Shopify platform - Expertise in custom liquid coding - Understanding of front-end development - Ability to execute based on samples Applicants should include a detailed description of their past experiences in creating custom liquid codes, specifically for Shopify. This will give me insight into your ability to successfully complete this project.
The objective for this project is to develop a conversation code written in C#. As a developer, I need a proficient freelance coder who has significant experience in C#. Upon completion, the code should be sent over as a file attachment. Key Skills Required: - C# coding expertise - Encryption Decryption expertise - Ability to develop interactive conversation codes - Accurate and efficient coding - Understanding of effective file attachment methods I just want console app that decrypt the provided payload in the ruby code, after you done, I will send some test data to make sure it I working correctly. Below code is written in Ruby I need same in C# see attached file
I'm in urgent need of assistance to convert my project into VB .NET. I'm seeking a freelancer with: - Significant experience with Visual Studio .NET. - Expertise in project creation, debugging, troubleshooting and implementation of database connectivity. - Proven ability to work quickly and effectively, as this project needs to be completed ASAP. Please note, the application type was not specified - further project details will be provided upon project commencement. Your broad range of experience will prove invaluable in this role.
I am in need of an expert in any server-side language to review and fix my web scraping code, which recently stopped functioning since this morning. I think the website implemented a bot-detector and may require a captcha solving. for NOW and must be fixed asap. Please don't use AI to respond to the bid, it's very noticable.
I recently purchased a piece of code from for personal use. However, I'm currently facing difficulties with the uploading process and I am in dire need of someone with vast knowledge and experience in cloud computing and server handling who'll be able to successfully upload it to the server. Since I skipped the database question previously, an understanding of various database systems would be notably beneficial, as this ambiguity will need to be sorted during the process.
I have web flutter language code. I need : WordPress work knownlage Updates some pages Add Amazon affiliate code ( I have account and links) I want fix some thinks And I want update my web domain Everything is ready Must have experience at Firebase database Flutter language coding WordPress work
Project Overview: We've already implemented a functional cookie consent banner with a script that manages cookie setting (setCookie, readCookie), consent selection (setCookieConsent), and banner behavior (checkbox initialization etc.). We need your expertise to integrate Google Tag Manager (GTM) with this existing script. We need conditional firing of a Google Analytics 4 (GA4) tag based on user consent selections (e.g., "Statistical" consent). I want these consent states to be managed correctly: ad_storage analytics_storage ad_user_data ad_personalization _personalization_storage functionality_storage security_storage and make settings adjusted for google v2 compilance. In your bid please write in short, what is new in Google v2 management. Bid only if you are already ...
I am in need of an expert in any server-side language to review and fix my web scraping code, which recently stopped functioning since this morning. I think the website implemented a bot-detector and may require a captcha solving. for NOW and must be fixed asap.
Freelancer Project: HTML/CSS Developer (Budget: Up to $45) Completion: 1 Day Project Overview: I'm seeking a proficient HTML and CSS developer to convert a straightforward Figma design into a clean HTML page. All styles must be embedded within the page, with no external references. This page is for customizing a Cloudflare challenge. Requirements: - Strong HTML and CSS proficiency - Experience translating Figma designs to HTML - Responsive web design expertise - Familiarity with SVG elements - Meticulous attention to detail - Ability to meet tight deadlines Project Details: - The straightforward page features a CSS gradient background, an adaptive SVG shape (no images), a logo (SVG), an h1 title, and a CSS container designated for a future Cloudflare widget implementation (by us...
I am in need of an expert in any server-side language to review and fix my web scraping code, which recently stopped functioning since this morning. I think the website implemented a bot-detector and may require a captcha solving. for NOW and must be fixed asap.
Looking for an expert in Prestashop, particularly with experience in modifying the website's code and database structure. The project will involve: - Reviewing the current code (1 file) which is working, focusing on its structure, organization and best practice. - Updating a database record subsequent to code activation. Ideal candidates will have a strong understanding of Prestashop, database management, as well as needful experience in code structure and organization. I anticipate code review, followed by assured database updates. Ongoing work available.
I need a Python expert to fix the error of ny code. I will share the code on chat box. Thanks!
As a Java developer, you're aware of how crucial unit tests are to ensure quality control. Here's what I need from you: - Develop unit test cases for my existing Java codebase to create over 90% test coverage. - The code's purpose has not been specified, so these tests must be comprehensive and consider a variety of use cases as a catch-all. Ideal Skills: - Extensive Java programming knowledge - Experience with Mockito and JUnit - Proficiency in software testing and quality assurance - Keen attention to detail I'm looking for a proficient developer who understands the balance between thoroughness and feasibility. Apply if you're adept at identifying critical test cases that most impact the software's functionality. Let's raise this codebase to new st...
I am in need of an expert in any server-side language to review and fix my web scraping code, which recently stopped functioning. for NOW and must be fixed asap.
I am seeking a skilled python programmer to prepare a porfolio(pdf file) with code documentation. Additionally, I need help organizing my GitHub account in a way that effectively showcases my projects for future employers. The ideal freelancer will have: - Proven execution in Python programming. - Experience in organizing GitHub projects for professional presentation. Those who understand the value of well-documented code and the necessary presentation on GitHub for catching potential employer's eyes are especially urged to apply.
I am in need of an expert in any server-side language to review and fix my web scraping code, which recently stopped functioning. for NOW and must be fixed asap.
I am in need of an expert in any server-side language to review and fix my web scraping code, which recently stopped functioning. for NOW and must be fixed asap.
I am in need of an expert in any server-side language to review and fix my web scraping code, which recently stopped functioning. for NOW and must be fixed asap.
I am in need of an expert in any server-side language to review and fix my web scraping code, which recently stopped functioning. for NOW and must be fixed asap.
...никому, и он должен работать так же. Итак, вы можете предложить мне какой-нибудь лучший способ сделать это. Например мы сможем подключить dll-файл, который отвечает за выполнение скрипта (не знаю, какая dll отвечает). Видео показывает работу скрипта внутри приложения. Например мы бы могли преобразовать код в двоичный, а затем изменить приложение таким образом, чтобы вместо чтения текстового файла VB оно считывало наш двоичный файл или около того.
I am in need of an expert JavaScript developer who can create a code that calculates poker outs, ***including runner-runner outs***, for Texas Hold'em Poker. Please read the attached document and make sure you understand it, and know how to do it, before bidding a price. PLEASE WRITE IN YOUR BID'S DESCRIPTION HOW YOU ARE GOING TO DO IT. Bids witout this descriptions will be ignored.
I am in need of a Shopify coding expert to help address an issue hindering my product promotions. The key problem lies within my Google Search Console, specifically an issue related to 'indexed, though blocked by '. Error are listed below: - Pages are Indexed, though blocked by - Alternative page with proper canonical tag (For all Pages) - Blocked due to other 4xx issue - Missing field 'aggregateRating' - Missing field 'review' - Invalid price format in property 'price' (in 'offers') - Invalid floating point number in property 'price' (in 'offers') - Missing field 'hasMerchantReturnPolicy' (in 'offers') - Missing field 'shippingDetails' (in 'offers') - Invalid string length in fi...
Javascript code to escape Instagram embedded browser to Safari on iOS, automatically redirect
We have around 705 source keys in two projects containing stings for an Android Music and Video app in English. The strings need to be translated into Spanish. Please note that the translated content will be proof-read and JUST copy-pasting from Google Translate will not be appreciated and the payment can be withheld.
I'm in need of a qualified professional to perform a penetration test on my Python code. My primary concern is injection flaws. I need someone to carefully check my code and ensure it is not susceptible to these types of vulnerabilities. In terms of access, I will provide Limited Framework/Design access to facilitate the needed tests. This task is ideal for someone who has: - Extensive experience in penetration testing - Proficiency in Python programming - In-depth understanding of potential injection flaws. This role requires a professional who can identify any threats efficiently and accurately to maintain the integrity of the code.
I'm looking for an experienced coder who can convert the be...for an experienced coder who can convert the below attached indicator from AmiBroker Formula Language (AFL) to pinescript for me. If you have previous experience in converting codes between these two languages, that is a big plus. Required Skills/Experience: - Expertise in coding AFL and pinescript - Clear understanding of trading indicators - Strong attention to detail and precision in code conversion. Please review the provided files thoroughly before proceeding with your bid for the project conversion. Kindly refrain from submitting bids without first examining my requirements. I value your time and mine, and I am open to discussing both the timeline and payment terms. Thank you for your understanding a...
Seeking a Reality Show Style look for poster image. These are salon workers. We want a VH1 Reality Show look to the company poster image. I really like the group photos. And try to add: DSC00398N (photo), DSC09980 (photo), and DSC00042 (photo) faded or however you see fit. TITLE IS: "BEYOND THE CHAIR”
I need an advanced software engineer with experience in C++ and embedded systems. Currently, I'm facing an issue where there's no PWM output in the audio player I have on STM32G030C8. The player needs to RAW Audio stored in an array via DMA. Here are my requirements: - Debug the STM32G030C8 code on STM32CubeIDE and resolve the PWM output issue using DMA I've verified the PWM configuration settings on STM32G030C8 from the datasheet and reference manual but the issue still persists. The fixing of this issue would entail a deep understanding and proficiency in debugging STM32 controllers. Previous experience in Timer PWM configuration would be advantageous . I've included all the project and generated files
Javascript code to escape Instagram embedded browser to Safari on iOS -- 2
Javascript code to escape Instagram embedded browser to Safari on iOS
Javascript code to escape Instagram embedded browser to Safari on iOS
I need a competent Lisp programmer's help in dealing with a nagging issue affecting my code. Specifically, it is producing incorrect outputs when engaging with certain external systems. Key tasks include: - Identify the root cause of the output error - Troubleshoot and rectify the logic flaws causing these errors - Make sure code is efficient, secure, and maintainable The ideal candidate for this role will have: - Proven experience working with Lisp and Autolisp even VBA. - Troubleshooting and debugging expertise - A good communicator that can take my rudimentary directions. To make it short, I have a code that is used for underground drilling permits in the CAD environment. I have a LISP suite that stations a line by generating notes, that generates MLead...
"Hi, I'm looking for an open-source source code that exactly matches the code of Jacku or TikTok, with all features and properties. I hope everyone understands the matter, and whoever has the required code should contact me."