Sms send mobile sample project asp net vb net punët
I need someone in Tirana to visit several shopping malls and send me some pictures and information. More info after I award the project. It will be one off visit, and not more than 10 pictures. Kam nevojë për dikë në Tiranë për të vizituar disa qendra tregtare dhe për të më dërguar disa fotografi dhe informata. Më shumë informacion pasi të jap çmimin e projektit. Do të jetë një vizitë dhe jo më shumë se 10 fotografi.
Ap iPhone/iPad Vetëm iPhone Mё duhet ta projektoj dhe ndёrtoj
Ap Android Mё duhet i projektuar dhe i ndёrtuar
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
Sample ghkjkjgkjgkjhgjkgjkgkjgjggkgjkgjkggjggjkgjgjkgjkgjkgjkgjkgjkgjgjgjgjgjkgkgjkgjgkjkgjkjgjgjkgkjkj
1 X Iphone App Update (Radio Umut) 1 x Android App (Radio Umut) 1 x Iphone App (Radio Bizim FM) 1 x Android App (Radio Bizim FM)
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
miredita shqipe pom duhet me qu shum emaila ndoshta munt te mundesh mem ndimuu te pershendes me tmira
I'm seeking a highly skilled freelancer to assist with in-depth Android application security assessment. Skills in the following areas are required: Static Application Analysis: Understanding of tools like...security assessment. Ideal Skills and Experience: Demonstrated experience in Android application security assessment, vulnerability identification, and mitigation advice. Specific expertise with Volatility, APKTool, and Ghidra. Ability to provide comprehensive project proposals including the following structure: Table of Contents Abstract Abbreviations List of Figures Introduction Conclusion References Note: I have an existing codebase for analysis and will provide it as a sample. Please include your previous work samples and detailed project proposals in...
I'm looking for a React and developer that integrate a Partical background to our website ASAP. We found this interesting sample: Although it looks like Vanilla implementation, we want it to be integrated into our react landing page. We are looking for someone to integrate the background exactly as it is just without a loading spinner at the top of our landing page instead of the big blue banner on our website:
We have a prototype of a software application that is almost ready but only one part is missing and is that we need a function that prevents from shutting down the mobile phone. And that's what our team needs help in.
I'm looking for a skilled mobile app developer with experience in designing and developing cross-platform applications for both iOS and Android. Key Requirements: - The app will primarily focus on freight and logistics operations, hence, your understanding of this domain and relevant experience is highly desirable. - The key functionalities that the app should provide include Freight Management and Route Optimization. You should have experience in: - Building cross-platform mobile applications - Integrating and developing applications for logistics and supply chain - Implementing freight management and route optimization functionalities in apps - Delivering user-friendly and intuitive mobile applications. Your understanding of modern UX/UI principles and trends...
I am looking to fill a longterm editor position for multiple projects for my agency. I am run...raw footage, edit it and upload the edited videos in a separate folder. I expect a simple thumbnail that fits the ratio 1:1 on Instagram feed. All videos should be edited in 9/16 format for fullscreen experiences on IG Reels + TikTok.* *Please reach out to me here on “Freelancer ” and tell me a bit about yourself, your current situation and show me previous work.* ***Important***: *I expect a sample to quality check your work, if I find qualified for the position, I will provide you with the raw 60-seconds footage.* *Fluent English is a must + you must be able to jump on a Zoom call to go through the onboarding process(webcam is a must).* *Daily reports are expected whenev...
...ready with all the necessary text content. It needs a necessary transformation to leave an impression on potential partners and clients. Your task would be: - Implementing a modern design style across the presentation to ensure its engagement with the corporate world. - Emphasise image selection. Images play the main role in this Project. They need to be intriguing and powerful, reflecting the uniqueness of our work at Sniper Action Photo. I will provide all of the sample images. - While the main focus is on the images, typography and color schemes should not be overlooked. They should complement the images and strengthen the overall visual appeal of the presentation. Ideal Skills and Experience: - Excellent understanding of aesthetic and modern design style. - Proficie...
...their services and availability. - Booking and Payment: Seamless booking and secure payment processing. - Calendar View for Schedule: A clear and organized view of the availability of service providers. - SMS Reminder: Automated reminders to reduce no-shows. - Partial Section for Advertisement: A space for beauty professionals to promote their services. Ideal Skills: - Experience in developing multi-platform applications. - Proficiency in user-friendly design. - Knowledge of secure payment gateway integration. - Previous experience with calendar-based applications. - Understanding of SMS integration for reminders. - Ability to implement advertising sections within an app. Please provide examples of previous work, particularly in the appointment booking realm. Your unders...
...based project for Short Term Office Rentals. We are seeking a qualified mobile app developer to create a cross-platform mobile application for both Android and iOS. Our current staging site is located at: Desktop: PWA: For the design of our Progressive Web App, we used the OpenTable application as the inspiration. Similar applications that have the same functionality as our sites are: Airbnb Zillow Our application currently has approximately 20 screens and includes payment processing through our own custom gateway. QUALIFICATIONS Minimum 4 Years experience with Mobile App development, with at 2 years of experience with Flutter framework Provide at least THREE (3) live and working Mobile Apps
I'm in ne...developer to integrate an SMS provider into my website. The main goal of my website is to provide SMS related services to our clients. The primary SMS provider we are planning on using is Plivo. Key Responsibilities: - Integrate the Plivo SMS API into the website, ensuring it functions seamlessly. - Implement the ability to receive messages through the API, giving our customers a full spectrum of SMS services. Ideal Skills: - Previous experience with the Plivo API is highly desirable. - Proficient in website development, specifically in integrating third-party APIs. - Strong understanding of SMS functionalities. - Excellent communication skills to translate the technical aspects into a user-friendly interface. - Familiarity with...
I need a skilled freelancer to extract table data from a PDF file. The extracted data will be used for analysis in a Microsoft Excel spreadsheet. Key Requirements: - Extract tables from a PDF - Ensure data quality and integrity - Deliver the data in a Microsoft Excel format Ideal Skills: - Proficiency in PDF data extraction - Strong understanding of tab...Excel spreadsheet. Key Requirements: - Extract tables from a PDF - Ensure data quality and integrity - Deliver the data in a Microsoft Excel format Ideal Skills: - Proficiency in PDF data extraction - Strong understanding of table structures - Experience in working with Microsoft Excel - Attention to detail and accuracy is crucial look attached PDF and EXCEL then Bid, start Bid writing PDF and sample attached. So I know you lo...
...insert into my videos to help make the boring parts of the videos fun. Key Requirements: - Expertise in Unreal Engine: Proficiency in Unreal Engine is a must, with a proven track record in creating high-quality animations and graphics. - 3D Animation Skills: The ideal candidate should have experience in creating character, object, and environment animations for film/TV. - 3D Graphics Design: The project also involves designing 3D graphics, so skills in this area are essential. - Photorealistic Animation: The animations should be of top-notch quality, aiming for a photorealistic level of realism. Ideal Skills: - Unreal Engine - Character, Object & Environment Animation - 3D Graphics Design - Photorealistic Animation Please showcase your previous work in Unreal Engine and 3...
I am looking for a competent mobile app developer to create an Android Internet Radio app that features a mix of content, including talk shows, music, and news and sports. This is what I require: - Development of the app solely for the Android platform - It would be a bonus if the app can support offline listening, but this is not a definitive requirement – I am open to discussion on this point. I provide access to my play store for the person to deploy the app. I will also submit the online radio link Ideal skills and experience: - Proven experience in mobile app development, especially in creating high-quality Android applications - Strong knowledge and experience with internet radio app creation would be highly advantageous - Exceptional understanding of the An...
I'm in need of a variety of visual assets and elements for my upcoming content project centered around renowned franchises like WH40k, LOTR, Cyberpunk 2077, and The Elder Scrolls. Here's a detailed breakdown of what I'm looking for: - Profile & Banner Pictures: Design visually appealing and brand-reinforcing profile and banner images that capture the essence of the respective franchises. - Branding & Templates for Social Media: Create cohesive branding materials and templates for social media platforms that embody the themes of Sci-fi, Fantasy, Cyberpunk, and Horror, with a specific focus on Machines & gears. - Static & Animated Visual Elements for Videos and Posts: Develop a range of static and animated elements that can be seamlessly integrated into...
I'm looking for a seasoned full stack developer with expertise in Flutter, React JS, and Node JS to build a comprehensive web application. The project will include, but not limited to: - Building a User authentication system - Implementing real-time notifications - Integrating data visualization tool The ideal candidate will have a proven track record of developing complex web applications. Familiarity with Firebase and Google Cloud is also a plus. Through this project, we aim to create a responsive, efficient and user-friendly platform. Your role will be crucial in achieving this goal. Please provide examples of web applications you have built previously that applied these skills, especially with real-time notifications and data visualization. I look forward to workin...
I need immediate help in implementing an OTP-based user authentication system. The project consists of - - OTP-based user authentication: The user should receive a unique OTP via SMS that they would enter to be authenticated. - React Native integration: The user interface needs to be seamlessly integrated and tested. - Node.js and MySQL: The backend should be designed to handle the OTP generation, validation and user details. I have a tight deadline and need this project completed as soon as possible. Ideal candidates should have: - Strong experience with React Native, Node.js and MySQL - Previous experience implementing OTP-based authentication - Able to work quickly and efficiently Please only apply if you're confident in delivering on time.
I'm looking for a skilled graphic designer to create a modern, visually appealing tri-fold menu for my pizza takeaway business. Content to be copied from our newly created website. I can provide sample menu card of our other store. It can be similar to that menu but design needs to be improved and eye catchy. Would be great if you can share sample of menu that you have. Timeline is very tight.
I need to convert my Wordpress website into mobile apps for both iphone and android. I require the converted apps to have push notifications features. Key Requirements: - Convert my Wordpress website to both iPhone and Android apps. - Implement push notifications feature for the mobile apps. Ideal Skills: - Proficiency in converting websites to mobile apps. - Experience in adding push notifications to mobile apps. - Familiarity with both iOS and Android app submission process.
...experienced .NET programmer to add a new feature to my existing application. Specifically, I need a modification to bypass member search by using a querystring. The page concerned is this:- We wish to have a direct url that replaces the process of searching for a member (eg member no 161068) and arrives at page two directly. For example, entering 161068 in the search box and selecting Checkedandvetted then pressing 'review this company' moves the user to page 2- review your experience. This is what we want to achieve with a single url. This is so that we can provide a url like that will do the same as the previous steps. Ideal skills for this job will include: - Strong knowledge of .NET programming
...MP3 file. To produce a top-tier result, it is crucial that the freelancer assigned to this project has a wealth of experience dealing with similar ventures in the past. Proficiency showcased in their previous assignments would be indicative of their capability to fulfill this job. This is what I am looking for in my ideal freelancer: - Extensive experience in noise reduction and dialogue isolation - Capable of working efficiently with MP3 formatted files - High attention to detail - Ability to deliver the project in a timely manner If you can meet these requirements, I'd be glad to hear from you. Please include your experience and relevant sample works in your proposal. I wish to have this project completed as soon as possible without compromising ...
I'm in need of a proficient developer with very specific skills for an exciting project. This project involves creating a poster maker for mobile platforms and should contain features like customizable templates and image importing. Key features and requirements of this project include: - Mobile platform compatibility: The poster maker should be intended for use on mobile platforms. - Feature implementation: It should possess two main features, 1. Ability to utilize customizable templates, and 2. Capability to import images. - Supported image formats: Importing of JPEG and PNG formats should be seamlessly facilitated. Ideal Skills: Expertise in mobile app development is required, with a profound understanding of integrating the requi...
I'm looking for an expert in digital marketing. Your role will be focusing heavily on converting leads to purchases and optimizing landing pages for enhanced User Experience (UX). Our mobile pages should be optimised to REDUCE BOUNCE and RETAIN CUSTOMERS. Key Responsibilities: - Develop highly effective digital marketing strategies - Lead generation and conversion through Google Ads - Optimizing landing pages for UX Ideal Candidate: - Proven experience in the above. Send examples of Landing Pages that you have designed. Your expertise with our target audience will be crucial for our campaign success. Let's convert leads into sales together!
Realizzazione un sito web con Primefaces (ultima release) e database MySQL. Il database deve con...con Primefaces (ultima release) e database MySQL. Il database deve contenere una lista di utenti e la loro anagrafica (nome, cognome, indirizzo) Gli utenti possono entrare nel sito tramite username (email) e password e vedono i loro dati che sono solamente la loro anagrafica. Dopo aver inserito le credenziali corrette, per accedere, gli utenti devono inserire anche un OTP (l'invio del codice via SMS) Prevedere una scadenza OTP e la possibilità di inviare nuovamente il codice OTP Acceso al database con JPA (o Spring Data JPA) Gestione acceso utenti con Apache Shiro Deve girare su un server con Java 17+ e Apache/Tomcat v.10 Progetto Maven Per la bozza grafica verranno fo...
I need the header on my WordPress site to be adjusted in its mobile version. The full header requires resizing. Key Responsibilities: - Resize the full header in the mobile version Ideal Skills and Experience: - Proficiency in WordPress development - Experience with responsive design, especially mobile optimization - Strong understanding of CSS and possibly JavaScript for more complex adjustments In your application, please provide a detailed proposal on how you plan to approach and execute this task. Past work examples of similar mobile optimization projects will be highly considered.
Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.
I'm looking for a talented article writer who can help me create engaging, detailed biographies around net worth analysis. The articles will need to cover different individuals and their professional and personal journeys. Key requirements: - Ability to research and compile engaging biographical content - Experience in analyzing net worth, and presenting it in an accessible way - Strong writing skills, with the capacity to deliver both professional and personal tones - Quality sources to back up the net worth and biography analysis The ideal candidate will have a mix of a journalist's curiosity and a financial analyst's precision. This project will offer an opportunity to craft insightful pieces on successful individuals, and delve into the fin...
I...for a mobile app developer to create a rideshare app that will be available on both iOS and Android platforms. Although I have a rough idea for the app design, I am open to suggestions from the developer. The most important feature that I want to include in the app is GPS tracking to ensure accurate location tracking for both drivers and passengers. Other features such as in-app payments and ratings and reviews are also important to provide a seamless and reliable user experience. Ideal skills and experience for the job include: - Proficiency in mobile app development for both iOS and Android platforms - Experience in implementing GPS tracking functionality in mobile apps - Knowledge of in-app payment integration - Familiarity with implementing ratings and reviews...
I'm looking for a skilled mobile app developer to work on a comprehensive mobile wallet application. This project will involve: - Design customization: I need distinct color scheme, font style, and layout tweaks to give the app a unique look and feel. - Server setup: I require load balancing, security protocols, and scalability options to ensure the app's performance and security. - Feature enhancements: The app should include payment integration, transaction history, and promotions/discounts features. - UI/UX improvements: I need assistance in redesigning the user interface to ensure a seamless, intuitive user experience. Ideal candidate for this project should have: - Proven experience in mobile app development, particularly with wallet appl...
I'm looking for a functional implementation utilizing AWS media convert in a .NET core environment, with a specific focus on video transcoding. - Functionalities: The main functionality to be implemented is video transcoding with the target being MP4 format. - Desired Output: The desired output resolution for the transcoded videos should be 1080p. Ideal Skills and Experience: - Significant experience with AWS Media Convert - Proficient in .NET core programming - Experience with video transcoding technologies - Understanding of video formats, particularly MP4, and resolution settings.
I have a private football manager game online. Written in PHP and TWIG. The script has already been adapted to PHP 7 (from PHP 5). 1. Now it has been noticed that 1 function, 1 module does not work properly under PHP 7. This module needs to be adjusted. 2. I need a few minor adjustments and functions in the game and in the admin area. 3. Then ...area. 3. Then I would like to have a new module. A calendar where you can see the days and what matches you have on those days. (Read from the existing database and display). And with some functions. You have to know that every extension to this script will be written in modules. These are then copied into the directories and taken over by the main script. Who can help? Further information and sample images if you are interested and c...
I'm in need of a skilled UI/UX designer who can use Figma to r...that I like, which I'd like you to incorporate into the design. I have a few specific layouts in mind that I'd like you to integrate into the new design. I will provide those examples of other apps and drawings to you. I will also give you access to the current assets we have for our mobile and desktop app now in Figma. The ideal candidate for this project would have: - Expertise in UI/UX design for both iOS and Android - Proficiency in Figma - A portfolio showcasing sleek, clean, and intuitive mobile app designs - Experience in advanced app design would be a plus I'd love to see how you can turn my vision into a visually appealing and user-friendly reality. I believe I need 9 s...
... - **Interface:** A mobile app interface will be ideal, making it easy for staff to work on the go. Inventory Tracking: - The system should involve manual entry for inventory tracking. The system should be user-friendly and easy to use for our staff. Skills/Experience: - **Mobile App Development**: You should have experience in developing mobile applications, particularly those with inventory management features. - **Analytics & Reporting**: Proficiency in integrating reporting and analytics tools into inventory management systems will be a plus. - **Warehouse Inventory Management**: Experience in developing similar systems for warehouse settings, particularly in retail, will be highly valuable. - **User Interface Design**: A good UI/UX design for t...
I want a simple platform using APIs and web sockets to collect real time data and calculate the values and show in the form of heatmap using plotly heatmaps. I need 4 features. Liquidation heatmap, order book, net position heatmap and liquidation level. Please read attached requirements before sending a bid. And please quote actual amount
Integrated Al-Quran Education System Development Brief: Create a digital platform for Al-Quran education that features student progress tracking and transparent reporting. The system will utilize PHP Laravel, Flutter or .NET Core, with MySQL/MariaDB on a Linux server. Key Features: User registration for different roles: Admins, Teachers, Guardians, and Students. Payment options both online and offline. Attendance and performance monitoring tools. Video tutorials for Quranic concepts. Requirements: Experience in educational technology. Quick turnaround and budget adherence. Deliverables: Complete web application. User guide and maintenance support. Proposal Needs: Approach, timeline, and cost.
I need a comprehensive HTML/CSS solution for my report pages. it must be clean code with easy names class and id's n...with easy names class and id's not generated with ai Key Requirements: 5 pdf files not just this one . - Create inputs: I'm in need of a web developer to build inputs that can be used to create a real report. - Input types: The report inputs should include text, number, and date inputs, as well as checkboxes and tables. - Layout: The layout of the report pages should be exactly as shown in the sample page I will provide. Ideal skills for this job include: - Proficiency in HTML, CSS, and JavaScript. - Experience with form creation and layout design. - Attention to detail to ensure the layout is replicated accurately. i have x5 reports needed to...
