Vb n punët
gggg uhhghygg tc oof n me uhhcsjuh ju HBO hmmmegcnuist hbr govmy uvhiidfff DC huh yfkv cc
N/a n/a n/a n/a hdhdhdndndndhdhhdhd
Z2VhcmJlc3Q6Ly93ZWJ2aWV3P3RpdGxlPVdBTlQlMjBGUkVFJTIwQ0FTSCUzRiUyMCU3QyUyMFNIQVJFJTIwJTI2JTIwQ09MTEVDVCUyMElUJnVybD1odHRwcyUzQSUyRiUyRm0uZ2VhcmJlc3QuY29tJTJGbW9uZXktYmFnLmh0bWwlM0ZhY3Rpdml0eVJlY29yZElkJTNENjQ4MTk3NDY5OTczMjE0MDAzMiUyNmxhbmclM0RlbiZmaXNzaW9uSWQ9NjQzNjE5NTE0NjE5MjYyOTc2MA==
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
xfgjhm gjdghjdjhjtyhjfhgjfh hjhndghhd nhdjdj jdjdh hdjhgjkkdd hdjfhkjkkdhstj j jtjtyj kyke ey ek eykekkjmfd fn n
xfgjhm gjdghjdjhjtyhjfhgjfh hjhndghhd nhdjdj jdjdh hdjhgjkkdd hdjfhkjkkdhstj j jtjtyj kyke ey ek eykekkjmfd fn n
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
azrhgvxqaa hgfryimùmln momo bybrbndfjkl:mm ifdsqsdeftghjkl 821453712 jhevdsfgjgtgh 5202553565jhgfd sdfghjklmgjwklxwsdfvghjkllmlkjhxbwhsnsjusjstsudgjdjdjsqloaqozsjufyfhfhfbhvcxxwmqwlkjhgtqs kqhndxksqhgxshxkiiwlow205254423552202jxhxkwxkwhwxkwhxix9572543636422565jvkxckxwxcb n n
dsklfvbsdfkbrglkjbcl;kbfgklnkljdfzxijgsfhkhjvzcbkjcvbzkjcbdfkjfbdfgbduhbbgrnklbxczkjnbkjldfnbsdgkljnlkdfdkdlbkjnvkbfagieurghkSJNVB;FSFDO;GIHPETHOUG;NVFDL;KBJRTPIOHNSAOVISPGGHDFIO NDSGPOHIRPOIDBNOFIHJSDPFOBISOHIGHODPOEWRIHGEOWTRIUBNTIUPHJPVUGPUIUHERHEROIREOHEROIREOTIEROITEROHTIERTOIHETOHERTOHERTHOERH...fbpoidjfghiodfjbhoidthjoaporyiusoepihjopwtihnmvbncvboihrtoiyroyieyotyeorieoglkdfgldfgljdfldflgeorterotueortoudcklvclvdl;ohohrot;hrdsjkvsjdksdjksgsdgshrshdfflkcklvbvcklbfglkbvlkjjkxcjvkkjvxcvkjvkbvcvkjbvvkjbvkjvxkjbvxkjbxvbkjvxkbjxvkbvvxkvxkbsfkbfsdkbsfkbsfkbsfskbsfdkbsfdkbfsdkbfdkoreieriotiotoieroitteroieriooirtoeiroicoig4547567456756jdkfbjkdbkndbkj4546564356jkbcvnbncvmdvcnvfnbvm,bnnbdfnb n ndfndfjnfj n nkjlg dkjn nkjn ndkjjkfghkjfhkfghnfgkjhjgkhjkdfgjkdfgjkrghkkdfhghkdfghkhkd...
Hi Kholid Muammar N., I noticed your profile and would like to offer you my project. We can discuss any details over chat.
1) Integrate Xproxy Server into the prebuilt web dashboard as discussed. 2) Admin N Customer dashboard 3) Load demo $ in the customer account and he buys the proxy Proxy gets assigned to the customer from the server with details like http, socks and user pass , and option to change auth from user?ass to IP auth With API button, he can change the user?ass from his dashboard.
Hi Naida N., I noticed your profile and would like to offer you my project. We can discuss any details over chat.
Hey...I need a n order form for my accadamic services offered in my site. Look at the to get the note not the web design...I have that sorted. I need admins and the client side. Payment gateways to integrate are PayPal, google pay and flutter wave.
Hi Antony N., I noticed your profile and would like to offer you my project. We can discuss any details over chat.
hacer un chatbot con base a N documentos (word, txt, excel, ) para generar respuesta generativas.. Necesito una consultiria porque necesito que eso se puede hacer .. Algun experto de copilot
We are in search of an intermediate level Java developer with in-depth knowledge on multi-threading. The main task presents a for loop which needs to be partitioned between n number of threads. Your skills and experience should include: - Solid understanding of Java programming language - Hands-on experience with multi-threading in Java - Proven experience with running Java applications with multiple threads To ensure your competency for the task, applicants should provide documentation of past work specifically highlighting instances with similar programming challenges. Join us in this interesting endeavor, let's make the code more efficient together!
I have a VBS script which downloads files from a server to the a folder on my local machine or onto AWS (MS Win Server 2012 R2). This script can be manually activated (double click) or via Task Scheduler. Recently the script stopped working. I think it has to do with AWS permission/read/write errors. I need to have this investigate and fixed. The person needs to understand AWS EC2 and VBS and JS scripting.
I will need 4 label designs. They are very basic designs. 0.6X2 CLEAR STICKER, BLACK WORDS “S T N Y” going down vertical and it should say “vapes” in a smaller font underneath 4x1.5 MATTE BLACK STICKER, WHITE WORDS “S T N Y” & “vapes” S T N Y with vapes in smaller font ( S T N Y in a psychedelic font) 3x2.5 MATTE BLACK STICKER, WHITE WORDS “LOW END THEORY” Make the "LOW END" small, Make "THEORY" USE A PSYCHEDELIC FONT FOR 3X2.5 FILES. I will attach 2 photos of fonts that I would like to use. The font that is in the circle should be used for 3x2.5. & The font that I took a photo of that says "inkisourroots" I would like to use that font for the 4x1.5 and 0.6x2...
Hi Antony N., I noticed your profile and would like to offer you my project. We can discuss any details over chat.
Just like the title says, i currently have a script on my site that displays text on mouse over, just not sure why it wont let me add line breaks; i can not give you access to the site, but i can send you the script. I have tried adding... '<br>, n, b, ' not really sure why its doing it. Thanks,
I need to assign a project related to the training of n. 1 employee who is part of my staff regarding software development with Angular language. The project involves assisting my junior developer for a maximum of 4 hours per week for a period of 4 months (total between 60 and 80 hours). Specifically, the sought-after figure will have to support my developer in case of problems related to writing the code relating to the development of our software called KAIZENCLOUD.
...Your keywords + On page + 400 quality Google Indexed backlinks monthly + Technical SEO + GA and GSC setup and Fix the issues + 4 article for backlink submission + 4 blog every month + GMB optimization Target For 1st month: Backlinks: 400 backlink *) Should be on google Indexed *) Min DA PA 40+ *) 90% should be Do Follow *) 90% should be Uniqueue Domain Total Keywords: 19 have current Position N/A After 1 month (25% keywords should br in Google SRP ) Working Keywords: Online Cake Birthday cake Buy cake online Birthday cake online Flower online Cake shop near me order birthday cake online flower bouquet online flower delivery in delhi gifts for boyfriend gifts for girls designer cake wedding cake photo cake 1st birthday cake birthday cake with photo kids cake cake de...
**Tour Costing Sheet Structure** 1. **Tour Details** - Tour Name - Tour Code - Duration - Destinations 2. **Client Information** - Client Name - Number of Adults/Children - Contact Information 3. **Accommodation** - Hotel Name - Room Type - Meal Plan - Cost per Night - Total Nights - Total Cost 4. **Transportation** - Vehicle Type - Distance ...6. **Miscellaneous Expenses** - Guide Fees - Entrance Fees - Other Expenses 7. **Pricing** - Subtotal (Sum of all costs) - Markup Percentage - GST (Goods and Services Tax) - Final Price 8. **Payment Details** - Deposit Required - Balance Due Date - Cancellation Policy Need for India Inbound Tour costing cost sheet, for India inbound in USD & Euro & Outbound in ...
Hi Maria N., I noticed your profile and would like to offer you my project. We can discuss any details over chat.
I’m seeking a professional designer to create a 6x9 book cover for my client's personal memoir soon to be published on both Kindle and Print through Amazon. Title is: FIVE DOLLARS AND A DREAM Author: ERASMO T. MUNOZ (place Spanish accent over the N) Print Length: 240 pages Key Requirements: 1. Incorporate a specific village photograph (attached) that I wish to use as a key element on the cover. This photo must be featured prominently in the cover design. 2. Use the attached photograph of the rancher as inspiration for the back cover design. 2. Create a cover that fittingly embodies the genre of a personal memoir. 3. Deliver a design that meets the formatting specifications for Kindle and Amazon Print. 4. Incorporate back cover text (synopsis and Author info) that I wi...
...Incorporate branding elements such as logo, colors, and imagery to create a cohesive look. - Include space for product descriptions, ingredients, and nutritional information. - Consider eco-friendly packaging options and materials. ****Additionally We need a creative concept for one packaging that have a place for the drink and place for the fries and place for the sauce so that the people can vary it n one hand and can fit the coffee holder inside the car.**** **Design Inspiration:** - Playful and vibrant designs that capture the essence of potato fun and excitement. - Incorporate potato-themed illustrations, patterns, and graphics. - Explore unique shapes and structures that stand out for takeaway customers. - Consider interactive elements or surprises that enhance the takeaway...
I am currently in need of a professional with exceptional forecasting and analytic skills. My focus is primarily on three sports: Football, Basketball, and Tennis. You required to either provide the following. 1.) Prediction strategies 2.) Web/App 3.) Python model Budget: 20$ N/B: I need a ready made solution ( not to build from scratch)
...1. Get subscription at OpesSignals 2. Forward the signals automatically towards Maestro scraper 3. Buy the signals and sell them automatically with the Maestro Telegram bot. ---- Some more indepth information about our service/product: O/p/e/s/S/i/g/n/a/l/s is not your standard crypto signals group. We won't tell you when to buy or sell or what your stop loss should be. Our signals seamlessly integrate with Maestro sniping, one of the largest automated bots for easily sniping (buying) and selling new coins. Subscribe to O/p/e/s/S/i/g/n/a/l/s and automatically receive the best signals, which you can then automatically forward to the Maestro bot to execute buy and sell orders automatically 24/7. This means you never have to worry about missing out on a new coin th...
Hi Iram N., I noticed your profile and would like to offer you my project. We can discuss any details over chat.
Hi Amir N., I noticed your profile and would like to offer you my project. We can discuss any details over chat.
Hi Kaleem Ur Rahman N., Its me again. I had a look at the study more closely, its good. i still need it to be less than 5000 words. i was hoping if you can work on reducing words. Thanks
I am in need of an experienced DJ or music producer to create an electrifying mix of some of my favourite Michael Jackson's songs. The mix is intended for a hip hop dance troupe, primarily in the pop genre. Key Deliverables: - A seamless, high-quality mix of the following Michael Jackson songs: Billie Jean, Thriller, Beat It, Working Day n Night, Smooth Criminal, Dangerous (notably the sound effects) and Wanna Be Starting Something. - Incorporate intricate transitions and radio play elements to the mix. Maximum of 3 minutes long Ideal candidate skills: - Previous experience in creating mixes for dance items - Strong knowledge of pop music and dance choreography - An understanding of Michael Jackson's style - Masterful mixing ability Please provide a brief outline of yo...
I am looking for a developer who is versed in Visual Basic, with a nuanced understanding of how to create in-game cheats. Specifically, I need a cheat developed for Game A that will run on a Windows PC. The cheat should offer two important features: - that has no interval In addition to the above listed features, the cheat should also enable a Wallhack function, allowing players to see through obstacles that would normally impede their vision. Desired Experience and Skills: - Prior experience in creating game cheats, preferably on a Windows PC platform. - Strong expertise in Visual Basic. - Deep understanding of Game A's coding structure. - Knowledgeable about crafting reliable cheats that won't cause game crashes or banning of users. Finally, I expect the cheats to funct...
Hi <font style="vertical-align: inherit;"><font style="vertical-align: inherit;"> روبرت ن. </font></font>, I noticed your profile and would like to offer you my project. We can discuss any details over chat.
Hi Armia Wassef Fayez N., I noticed your profile and would like to offer you my project. We can discuss any details over chat.
...account to complete the payment then upon successful payment they will be reverted to the payment success screen. Additionally you will add a field into the product category table and to the product add/edit pages in the admin panel for payment options allowed. Certain product categories can be paid with credit card whereas the others cannot. So something like cc_allowed and the answer would be y or n. Upon the options in the checkout if cc not allowed then this option won’t be available to the customer. You will do the above mentioned functionality and pages and popups if need be. There will also need to be a way to test this functionality before it goes live to the public. This project is only for one individual (no agencies) that currently has no work load and can co...
Hi, I need some active freelancers to help me to complete my project on the required information will be given.A test will be taken to accomplish the is the local Listing agent n are most welcome. Thanks
...need to include the date the option was selected selected and because you can't have two formulas in conditional formatting. I thought making a cell in the below row for the date was the only option - any other options to achieve this? Column A, Row 3 contains Client Name (code), Columns B-K, Row 3 contains the course 14 x units. Column A, Rows, 5 - 19 contains student names. The cells in Columns B-N, Row 5 will include the submission options with a drop down menu or alternatively. The 5 different grading options are: Not yet started Not yet submitted Submitted for marking Partially Complete - More work to submit Competent Each cell and submission option will be selected from a drop down list and needs to have a different fill colour (#b4c6e7, #ffd966, #ffff00, #fff2...
Hi Nhat N., I noticed your profile and would like to offer you my project. We can discuss any details over chat.
