Vb net code payment confirmation paypal punët

Filtër

Kërkimet e mia të fundit
Filtro sipas:
Buxheti
deri në
deri në
deri në
Lloji
Aftёsitё
Gjuhët
    Shteti i punës
    2,000 vb net code payment confirmation paypal punët e gjetura, me çmimin EUR
    Produkt kozmetike -- 2 Ka përfunduar left

    Projekti: Përkthim i një broshure reklamuese për një produkt të ri kozmetik në gjuhët angleze dhe gjermane. Përshkrimi i projektit: Kërkoj një përkthyes profesional për të përkthyer një broshurë reklamuese për një produkt kozmetik të ri në gjuhët angleze dhe gjermane. Broshura përmban rreth 1000 fjalë dhe kërkoj që përkthyesja të jetë në g...përkthim të besueshëm, të saktë dhe të qartë për të siguruar që produkti të shitet me sukses në tregjet anglisht dhe gjermanisht. Afati kohor: Afati i projektit është 10 ditë nga pranimi i projektit. Shërbimet që ofrohen: P...

    €17 / hr (Avg Bid)
    €17 / hr Oferta mesatare
    9 ofertat
    Produkt kozmetike Ka përfunduar left

    Projekti: Përkthim i një broshure reklamuese për një produkt të ri kozmetik në gjuhët angleze dhe gjermane. Përshkrimi i projektit: Kërkoj një përkthyes profesional për të përkthyer një broshurë reklamuese për një produkt kozmetik të ri në gjuhët angleze dhe gjermane. Broshura përmban rreth 1000 fjalë dhe kërkoj që përkthyesja të jetë në g...përkthim të besueshëm, të saktë dhe të qartë për të siguruar që produkti të shitet me sukses në tregjet anglisht dhe gjermanisht. Afati kohor: Afati i projektit është 10 ditë nga pranimi i projektit. Shërbimet që ofrohen: P...

    €30 / hr (Avg Bid)
    €30 / hr Oferta mesatare
    2 ofertat

    Pershendetje, kam pyetje per krijim te aplikacionit IOS dhe Android. ...një gamë të çmimeve bazë për ato. Ne si kompani e dimë se çdo projekt është unik. Gjithsesi, është e rëndësishme të njohim një gamë të çmimeve bazë të disa aplikacioneve bazë si: Shembulli 1: 1) Dyqani Online me rreth 100 produkte 2) Dizajn korporativ është prezent nga kompania 3) Metodat e pagesës: PayPal, Creditcard Shembulli 2: 1) Rezervimi i aplikacionit për një restorant apo hotele 2) Mundësitë e rezervimit (rezervimi i një tavoline, rezervimi i një dhome) 3) Metodat e pagesës: PayPal, Creditcard Pyetje të tjera janë: A ...

    €1969 (Avg Bid)
    €1969 Oferta mesatare
    4 ofertat
    Programing Ka përfunduar left

    Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc

    €11205 (Avg Bid)
    €11205 Oferta mesatare
    4 ofertat
    Crie um Website Ka përfunduar left

    Desenvolvedor .NET MVC, SQL e ADVPL Protheus

    €2721 (Avg Bid)
    €2721 Oferta mesatare
    1 ofertat
    qefqreqweqawdafsc Ka përfunduar left

    asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr

    €183 (Avg Bid)
    €183 Oferta mesatare
    1 ofertat

    Pozdrav dali mozete rijesit spajanje virtuemarta na joomli 3 na Corvus payment gateway

    PHP
    €46 (Avg Bid)
    €46 Oferta mesatare
    1 ofertat
    yveguwvcjnjnecbkhb Ka përfunduar left

    ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif

    €105 (Avg Bid)
    €105 Oferta mesatare
    1 ofertat
    fritsee.com help on php code Ka përfunduar left

    hi i need support

    PHP
    €8 / hr (Avg Bid)
    €8 / hr Oferta mesatare
    1 ofertat

    ...current in production running in Azure and built on .NET Framework 4.8 platform using C#, ASPNET MVC, AngularJS, OpenTok Video Comm Components (Vonage) and Syncfusion UI Components. It is running on top of a SQL Server DB (created via EntityFrameWork CodeFirst) for persistence with ties to Twilio for SMS and SendGrid for email communication. There is also a WebAPI project that is part of the solution that may need to be enhanced for this migration effort. The initial groundwork was done by another developer who was unable to complete the work. I need a good development team (2-3 developers) with excellent communication skills who are willing to build upon the the infrastructure already created and complete the migration of the application to .NET Core (C#) quickly which...

    €19 / hr (Avg Bid)
    MRS
    €19 / hr Oferta mesatare
    5 ofertat

    Retrieve website source code (Css, html, JS). Website need it to be working on local machine. Use free domain & free hosting service to host the website. Check out this website: Must type "orange" in the proposal. Project must be done within the budget. Project will not be awarded to those who bid less then increase the rate.

    €26 (Avg Bid)
    €26 Oferta mesatare
    68 ofertat
    Figma-to-JS E-commerce Development 6 ditë left
    VERIFIKUAR

    I'm in need of a proficient developer who can transform my Figma concepts into a functional Next JS front-end, tightly coupled with a comprehensive backend. Specific backend functionalities required include: - User authentication - Database integ...into a functional Next JS front-end, tightly coupled with a comprehensive backend. Specific backend functionalities required include: - User authentication - Database integration - API integration The purpose of our undertaking is to develop an e-commerce platform. Your role would encompass integration of a payment gateway as well, starting with PayPal. Ideal bidders should possess firsthand experience in Figma, JavaScript (specifically Next JS), backend development, and broad PayPal API expertise. Looking forwar...

    €17 / hr (Avg Bid)
    €17 / hr Oferta mesatare
    117 ofertat

    I'm looking to hire an experienced app developer, proficient in both iOS and Android platforms. The main focus of the project is testing and upload of code for play store verification as the code and interface is already done. Ideal Skills:. • Expertise in iOS and Android App Development, testing and upload on play store and app store • Experience in designing reward-based systems Key Features I expect: • A fully functional reward system to incentivize referrals. Feel free to bid if you meet these criteria and are ready to work in a collaborative and agile environment.

    €99 (Avg Bid)
    €99 Oferta mesatare
    9 ofertat

    ...thereby improving the user experience • Utilize engaging content to generate leads and sales Lastly, the content should be appealing to a broad audience, specifically targeting millennials, parents, and business professionals. Hence, versatile but precise content creation skills are necessary. Let's join hands to make your first project a resounding success. Note -- bid with INR 749.52 as confirmation you read details here. thanks...

    €13 (Avg Bid)
    €13 Oferta mesatare
    40 ofertat

    ...and Sellers), CRM integration, SMS, Email, Whatsapp (OTP verification, promotion, etc) to be suggested by freelance designer for smooth functioning of marketplace APIs – Vendor validation with Aadhar, GSTIN, Bank Account (GSTIN name to match with Bank account). For buyers also looking for basic validation of mobile number and email id Payment gateway – Will be provided mid way through the project LOGO and other resources will be shared on project confirmation and basis requirement. Please note that customization of complete theme, plug-ins, etc is required at every stage / level so that the project is completed thoroughly without having to depend on another agency. Website should load between 3-5 seconds max. Before awarding the project the freelancer needs ...

    €344 (Avg Bid)
    €344 Oferta mesatare
    57 ofertat

    I'm seeking a skilled freelancer to install and configure the aMember platform on a WordPress site. You'll be focusing on several functionalities and key features, and these include: - Enabling the user registration and login function. - Mana...Managing subscriptions. - Controlling content access based on subscriptions. The ideal freelancer for this job should be proficient in WordPress and possess a deep understanding of the aMember platform. It would be beneficial to have experience in setting up and configuring these features on similar projects. Further, the payment gateway to integrate with the aMember platform is PayPal. The successful bidder should have a thorough understanding of how to integrate PayPal into aMember to ensure a smooth and seamless ...

    €122 (Avg Bid)
    €122 Oferta mesatare
    109 ofertat

    I need to make some small changes on the wordpress payment gateway already made

    €118 (Avg Bid)
    €118 Oferta mesatare
    214 ofertat

    We are looking for an experienced C#/.NET developer to fix issues for the existing Inventory management app. The app was integrated with the MySQL database. Requirements - C#/.NET Framework - desktop application development - MySQL database

    €134 (Avg Bid)
    €134 Oferta mesatare
    38 ofertat

    I am looking for a skilled Flutter developer to create a mobile application for both iOS and Android for my existing .net web project. The application will have the following features: - NFC and QR code scanning functionality for gathering information. - Ability to create points of interest that can be viewed on maps. - Real-time location tracking. Ideal Skills: - Proficiency in Flutter Development, .Net, and familiarity with NFC and QR technology. - Prior experience in creating map-based applications. - Knowledge of Turkish language, as the app will only support Turkish at this stage. Please provide examples of your previous work related to these technologies while bidding on this project.

    €170 (Avg Bid)
    €170 Oferta mesatare
    67 ofertat

    I need someone to help me to write a simple code by C programming language.

    €15 (Avg Bid)
    €15 Oferta mesatare
    37 ofertat

    I'm looking for a talented app designer who can craft minimalist screens for my project. The core functionalities in focus are user registration/login and payment processing. Key Requirements: • User Registration/Login Screen Design: I want an intuitive and user-friendly design. Please prioritize ease of navigation and clarity. • Payment Processing Screen Design: The screens should make payment process efficient and straightforward for users. • Multilingual Support: The screens need to support multiple languages. Please, highlight your experience in designing multilingual apps. Ideal candidates will have a clean, modern, minimalist aesthetic in their portfolio. Exceptional attention to detail and a user-oriented design approach are highly sou...

    €982 (Avg Bid)
    €982 Oferta mesatare
    174 ofertat

    I'm seeking an experienced STM32 developer who can assist me in developing a small code for a vending machine that operates in three states. It is a small project which only needs a demonstration. The code is required in couple of hours, so bid only if you can work immediately. Thanks for consideration.

    €18 (Avg Bid)
    €18 Oferta mesatare
    12 ofertat
    QR Code-Based Landing Page Design 6 ditë left
    VERIFIKUAR

    I need a landing page designed for my company, which can be accessed via a QR code and a direct web address. The main purpose of this landing page is to provide information about the company. Specifically, it should prominently display: - Our current location - Future locations - Menu - Contact info The navigation menu should be intuitive and include these elements: - Home - About Us - Services/Products - Locations - Contact Ideal candidates for this projects should have experience in responsive web design, and a strong understanding of UI/UX principles to promote smooth site navigation. A solid background in SEO to optimize the page for search engines will be an added asset.

    €130 (Avg Bid)
    €130 Oferta mesatare
    231 ofertat

    Description: We are looking for web & app designers to help test a product that helps designers find illustrations. You will be required to use our illustrations in a realistic scenario and give us feedback about your experience. You will receive payment for every real website or app that you designed and where you use at least one illustration from our platform. Tasks: - For any of your work, if possible, try to include illustrations from our platform - Provide feedback for our platform while you are using it to find illustrations - You will receive a payment reward of up to $100 USD once the project is launched in public. We are also open to consider different forms of payments, incl. hiring you on a regular basis for repeated work. Expectations: - You are a web o...

    €119 (Avg Bid)
    €119 Oferta mesatare
    28 ofertat

    ...an experienced Python developer to optimize and automate my existing Python functions. This role does not only involve data analysis; it also involves file manipulation and web scraping. Now let's check out what you'll be working on: - Revamping Function: The existing function needs to be automated so it works effectively and efficiently. This includes working with modifying and optimizing the code. - Mobile Signature: Another crucial area you'll be dealing with is to implement mobile signature in the script to facilitate its operation. - Task Automation: The function should be programmed to undertake specific tasks. These include fetching data from a website and updating a database accordingly. Ideal Skills: - Python scripting - Mobile signature implementatio...

    €24 (Avg Bid)
    €24 Oferta mesatare
    74 ofertat

    ...pedido, stocks, descripciones, imágenes de productos, etc... 2. Activación, Configuración y Personalización de las diferentes aplicaciones de Odoo 17 que necesitamos para el correcto funcionamiento de la empresa (Ventas, Facturación, CRM, Sitio Web, Inventario, Contabilidad, Compra, Punto de Venta, Proyecto, Comercio electronico, Fabricación, Marketing por email, Studio, Documentos, Empleados, POS Payment Configuration, POS Productos Multi Barcode, Firmar, Planificación, Eventos, Conversaciones, Contactos, Alquiler, Servicios Externos, Marketing Social, Evaluaciones, Flota, Automatización de Marketing, Consolidación, Charla en vivo, Encuestas, Marketing por SMS, Internet de las Cosas, Códigos de barras, Notas...

    €1164 (Avg Bid)
    €1164 Oferta mesatare
    56 ofertat

    In this project, I am seeking an expert to consult on low/no-code Android app development. As I'm currently unsure which avenue to pursue, your guidance will be instrumental in selecting the proper tool suitable for my app. Key services that will be needed include: - Detailed recommendations on low/no-code platform choice. - Guidance on moving from low/no-code platform to Playstore. The ideal candidate should have: - Experience with various low/no-code platforms. - Strong grasp of Android app development. - Ability to provide clear and actionable advice. If you can demystify Android app development on low/no-code platforms and guide me in the right direction, I'm looking forward to hearing from you.

    €112 (Avg Bid)
    €112 Oferta mesatare
    39 ofertat

    As someone requiring assistance in managing my React Native code, I'm looking for a skilled GitHub manager to not only set up my GitHub repository but also handle code reviews and feedback. Although I have no specific guidelines or requirements concerning the code review process, the ideal candidate should: - Set up a GitHub Repository - Help or guide us to Upload the React Native Source Code to GitHub - Help or guide us to open the code review and valuable feedback Efficiency, attention to detail, knowledge of handling React Native code, and experience in managing GitHub repositories are essential skills for this project.

    €124 (Avg Bid)
    €124 Oferta mesatare
    141 ofertat
    Excel 365 Data Entry Specialist 6 ditë left
    VERIFIKUAR

    I am seeking an expert in Excel 365 who can highly perform simple data entry tasks. You should ideally have: - A deep understanding of Excel 365's functions and user interface - Precise attention to detail - Simply u have to enter issued number against received number - For example :- In department of DSC you have to 1st go to DSC sheet then 1st enter ...Precise attention to detail - Simply u have to enter issued number against received number - For example :- In department of DSC you have to 1st go to DSC sheet then 1st enter date like as per photo that was 28/01/2024 than 1st find number "574" by finding function than entry "147" in 28/01/2024 column. Please understand first approx. 5000 entry u have to enter as per above mentioned. After confirmation...

    €10 (Avg Bid)
    €10 Oferta mesatare
    52 ofertat

    I have an intricate Python code focused on algorithm implementation. My primary aim is to have this code converted to Scheme language. This initiative is part of my learning process for Scheme programming. The complexity of my Python code is quite high. It contains several modules and dependencies that need accurate and expert conversion. Due to the complexity of the task, the ideal freelancer should be proficient in both Python and Scheme languages. Key Job Requirements: • Strong Python programming skills • Expertise in Scheme language • Experience with complex code conversions • In-depth understanding of algorithm implementation • Experience with handling multiple modules and dependencies Your solid understanding of the two langua...

    €119 (Avg Bid)
    €119 Oferta mesatare
    34 ofertat

    ...6-12. Our program details can be found on: We have trained hundreds of US children online and have excellent testimonials. We can send an info pack to interested clients. Your ad should have a strong Call to Action that will drive parents to complete the Enquiry form on our website. You can find ideas for the content by searching the net with the key words: MIDBRAIN ACTIVATION that will bring up companies that promote similar programs: 1) Seeing without eyes 2) Quantum Speed Reading. We plan to place the ads on Florida Newspapers The key message to convey is the fun and educational activities for children. A successful copy should be able to: - Effectively communicate the benefits and

    €205 (Avg Bid)
    €205 Oferta mesatare
    75 ofertat

    buenas tardes, quisiera realizar un sitio web con 2 páginas internas ( una de inicio y otra para los 3 productos ) Tambien necesitamos que tenga instalado plugins recomendados mas Google Pay, Apple Pay, Stripe y PayPal.

    €46 (Avg Bid)
    €46 Oferta mesatare
    97 ofertat

    I have a C project that needs to be delivered by tommorow. I need some EXPERT in C to help me finish this. Most part is done. Analytical details in chat. Budget: $65 USD

    €66 (Avg Bid)
    €66 Oferta mesatare
    45 ofertat

    ...developer who could significantly improve an existing Android application built on .NET with SQL backend. Major tasks include: - Redesigning UI/UX to make the app more intuitive and user-friendly - Adding more interactive elements to keep users engaged - Improving navigation for a flawless user experience - Identification and fixing of bugs, coupled with performance optimizations for a smooth application flow - Integration of new features such as push notifications, in-app messaging, and creation of 'Course Sections', Course Notes Section - Reworking of the 'Find Jobs' section to make it more efficient - And with complete new Login and Sign pages. Ideal freelancer should have: - Extensive experience with .NET, SQL, and Android app development - Pr...

    €311 (Avg Bid)
    €311 Oferta mesatare
    26 ofertat
    n8n.io low code 6 ditë left
    VERIFIKUAR

    Key Tasks: - Establish an API with to facilitate workflow automation. - Integrate and automate transmission of data between open ai and my backend Qualifications: - Experience with ,OpenAI, and my backend. - Knowledge in automated workflow design and execution. The project's goal is to automate specific processes within my workflow, focusing on data transmission between APIs and condition-based task execution. You'll need to demonstrate familiarity with and proficiency in managing and integrating APIs. The successful execution of this project requires a solid understanding of workflow automation and data integration strategies.

    €12 (Avg Bid)
    €12 Oferta mesatare
    2 ofertat

    I am seeking a skilled developer to integrate a payment gateway system that will accept debit/credit cards and convert those payments into Bitcoin, Ethereum, and USDT. Key Aspects: - Integration of a payment gateway for accepting debit/credit cards - Seamless conversion of these payments into desirable cryptocurrencies (Bitcoin, Ethereum, USDT) - Shouldn't require KYC for each new customer Ideal skills and Qualifications: - Experience in payment gateway integration - Familiarity with Stripe or or any similar payment gateway - Profound understanding of Bitcoin, Ethereum, and USDT, as well as other Cryptocurrencies

    €509 (Avg Bid)
    €509 Oferta mesatare
    16 ofertat

    ...efficient, and robust second-hand fashion marketplace. Key Project Requirements: - Integration with specific brands: Brand A, Brand B, and Brand C. Your experience in delivering brand integrations is crucial. - Payment gateway integrations: My platform needs to accept PayPal, MBWay, and Credit Card payments. Proven track record in similar integrations is expected. - Feedback system integrations: We'd like a system where buyers and sellers can easily rate and review each other. Preferred Skills and Experience: - Proven experience in developing online marketplaces - Expertise in payment and brand integration - Understanding of effective feedback systems within online marketplaces. I'm expecting a thorough quote that includes timeline, technology sta...

    €2212 (Avg Bid)
    €2212 Oferta mesatare
    186 ofertat

    ...our travel agency that showcases our services, destinations, and packages. * Integrate a secure payment gateway compatible with Malaysian currencies and banks to facilitate online bookings. * Implement a booking system allowing customers to select travel dates, destinations, and packages, with automated invoice generation and email confirmation. * Create a quotation request form for customers to submit special requests for customised itineraries or group bookings. Requirements: * Proven experience in web development, with a portfolio showcasing previous website projects. * Proficiency in relevant programming languages and frameworks (e.g., HTML, CSS, JavaScript, PHP). * Experience integrating payment gateways and booking systems into websites. * Strong attention to...

    €439 (Avg Bid)
    €439 Oferta mesatare
    227 ofertat

    I encountered an issue with the PayPal button on my site. what i want is : once the user fill 2 edit fields (wallet and amount ) the content of the 2 edit fields should be sent to a given email address after a successful payment. that's it. attached to this description you will find the html-file with the information i talked about. the max budget for this small task is $10. thank you

    €17 (Avg Bid)
    €17 Oferta mesatare
    89 ofertat

    Attention. Those who are ready should apply. People who only send requests should not apply. I am looking for a Cora PHP specialist who can add VIEWS code to the control panel. When the news articles are viewed by the users, it should be displayed in the control panel. Views should not be repeated, it should remember the user's ip address or device

    €19 (Avg Bid)
    €19 Oferta mesatare
    77 ofertat

    ...Elixir developer well-versed in troubleshooting and correcting open source code, specifically for Mobilizon—an event planning platform. There's an immediate need to address bugs and errors affecting both the User Interface (UI) and functionality of the platform's features. Key areas that require attention: - Resolve UI issues tilted towards the incorrect computation of available seats for events - Address the affected functional features associated with UI errors See this link for details of bugs: (note that the project owners have quoted a 500 euro fee to fix this themselves, but this is excessively high for something that is small code fix.) Will provide SSH access to my instance of Mobilizon to troubleshoot

    €385 (Avg Bid)
    €385 Oferta mesatare
    3 ofertat
    Test Payment 9 ditë left

    Detailed proposal already sent.

    €12 / hr (Avg Bid)
    €12 / hr Oferta mesatare
    1 ofertat
    Android APP with Stripe-M2 Reader 6 ditë left
    VERIFIKUAR

    Android APP connected to a Stripe M2 terminal. The app will have 4 buttons (Options) each one with its own price and title, when user selects one option the app will connect to the stripe M2 terminal to collect payment based on the price of the option selected, when payment is done, a confirmation screen will appear and go back to home. Android Studio

    €147 (Avg Bid)
    €147 Oferta mesatare
    53 ofertat

    ...days for this task. **Project Overview:** I have a PHP Laravel source code that includes a licensing program, and I am looking for a talented developer to remove the entire licensing mechanism. Once the licensing program is successfully removed, I expect the freelancer to hand over the complete source code. I can provide a hosting package for testing purposes, or the freelancer is welcome to use their own hosting account. **Deliverables:** 1. Removal of the licensing program from the source code. 2. Handover of the complete source code. 3. Testing on provided hosting or freelancer's own hosting account. **Additional Requirements:** I request detailed change logs documenting every modification made to the source code during the process. This wil...

    €20 (Avg Bid)
    €20 Oferta mesatare
    17 ofertat

    It is necessary solve some few errors that have my application. It is necessary experience in laravel coding. Please send me your experiences in complex coding not simple web). If you show me the experiences, I will send the details of changes

    €74 (Avg Bid)
    €74 Oferta mesatare
    141 ofertat

    As an entrepreneur looking to expand my digital footprint, I need a team of programming experts proficient in Python, Java, and C++. Your task will be two-fold: 1. Web Application Development: Design and develop a web application from scratch, taking care of the UI/UX design, back-end functionality, and ensuring smooth user navigation on the platform. 2. Mobile App Development: Mirror the web application in the form of a fully functional mobile app, compatible with both Android and iOS. Ideal applicants should have previous experience in web and mobile app development and a solid understanding of the specified programming languages. Collaborative team players and those with a knack for problem-solving will be given priority. We value open communication so be prepared to participate in ...

    €8 / hr (Avg Bid)
    €8 / hr Oferta mesatare
    9 ofertat

    As an Arduino and Python developer, I'm looking for expertise to create a comprehensive flowchart that outlines the logic and working of an existing Arduino and python code. This is an essential task to me because I want to understand the sequential order of operations, from start to end. Main Focus: - Emphasizing the relationship of different features coded, and their flow from start to completion. - As one knows, the different parts of the Arduino code work together in achieving specific output, hence, a skilled understanding of the code's hierarchy is of great relevance. Ideal candidate: - Proficiency in Arduino and Python language. - Strong experience in flowchart development. - Ability to analyze complex scripts and map process flows. - Detail-oriented and t...

    €16 (Avg Bid)
    €16 Oferta mesatare
    44 ofertat

    High-Paying Sales Opportunity! ? Are you a top-performing sales professional looking for a lucrative opportunity? Look no further! We are offering an exciting position with the potential to earn a substantial income. Role: Senior Sales Executive Responsibilities: Drive sales and meet revenue targets Develop and maintain relationships with key clients Identify new business opportunities and market trends Requirements: Proven track record of success in sales Strong negotiation and communication skills Ability to work independently and as part of a team Benefits: Competitive base salary and commission structure Additional performance-based bonuses Flexible working hours and remote work options If you're a motivated sales professional looking for a high-paying opportunity, we want t...

    €3571 (Avg Bid)
    €3571 Oferta mesatare
    10 ofertat

    I'm in need of an experienced .NET/Angular developer who can build me an e-commerce website. Your task will primarily involve: - Creating a User registration and login system. - Establishing Product search and filtering capabilities. - Implementing a Shopping cart and checkout system. Moreover, it's essential for the website to support different payment methods. These should include: - Credit/Debit cards - PayPal - Bank Transfers This project will require someone with a proven track record in developing responsive and user-friendly e-commerce websites. Knowledge of .NET API and Angular are non-negotiable. If you have these skills and can complete this project ASAP, please get in touch.

    €156 (Avg Bid)
    €156 Oferta mesatare
    11 ofertat

    I am seeking a team of skilled freelancers who are proficient in a diverse range of programming languages. Key skills ideal for this job include: - Experience in .NET, Python, and JavaScript - Experience with Web API and SQL server - Familiarity with Power Apps, Power Automate, and Power BI - Experience in Azure, DevOps, and CRM D365 As someone with over eight years of experience in software development, I expect high-quality output. I am particularly interested in those who can demonstrate robust experience in these areas, so please include your past work and detailed project proposals. This will aid me in making an informed decision in my selection process. I am looking forward to engaging with a dedicated, well-versed team for long-term collaboration.

    €31 (Avg Bid)
    €31 Oferta mesatare
    22 ofertat