Vb net sample project code access database restore data backup punët
Qysh je qa bone deshta me te pyt a din me mnimu ne ReactJS me bo 1 searchbox me hooks qe ka access ndatabase(firebase). vetem kjo funcionality po mvyn me shtu.
Qysh je qa bone deshta me te pyt a din me mnimu ne ReactJS me bo 1 searchbox me hooks qe ka access ndatabase(firebase). vetem kjo funcionality po mvyn me shtu.
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
Sample ghkjkjgkjgkjhgjkgjkgkjgjggkgjkgjkggjggjkgjgjkgjkgjkgjkgjkgjkgjgjgjgjgjkgkgjkgjgkjkgjkjgjgjkgkjkj
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
I'm looking for a skilled graphic designer to create a modern, visually appealing tri-fold menu for my pizza takeaway business. Content to be copied from our newly created website. I can provide sample menu card of our other store. It can be similar to that menu but design needs to be improved and eye catchy. Would be great if you can share sample of menu that you have. Timeline is very tight.
...experienced .NET programmer to add a new feature to my existing application. Specifically, I need a modification to bypass member search by using a querystring. The page concerned is this:- We wish to have a direct url that replaces the process of searching for a member (eg member no 161068) and arrives at page two directly. For example, entering 161068 in the search box and selecting Checkedandvetted then pressing 'review this company' moves the user to page 2- review your experience. This is what we want to achieve with a single url. This is so that we can provide a url like that will do the same as the previous steps. Ideal skills for this job will include: - Strong knowledge of .NET programming
...MP3 file. To produce a top-tier result, it is crucial that the freelancer assigned to this project has a wealth of experience dealing with similar ventures in the past. Proficiency showcased in their previous assignments would be indicative of their capability to fulfill this job. This is what I am looking for in my ideal freelancer: - Extensive experience in noise reduction and dialogue isolation - Capable of working efficiently with MP3 formatted files - High attention to detail - Ability to deliver the project in a timely manner If you can meet these requirements, I'd be glad to hear from you. Please include your experience and relevant sample works in your proposal. I wish to have this project completed as soon as possible without compromising ...
The task is to tag for deletion, the cases on my data sheet that are settled, and where they sold the property, so I can perfect my data in my CRM (Go High Level), so we prospect opportunities. To do this, you need to look up the case number and required you can access the sites from your country of origin either directly of through the use of a VPN. No exceptions! I have attached a sample file so you can see the scale. Only detail oriented, highly organised persons will be considered. Let's see if we are a fit!
Hello, I have a dating app that was developed 4 years ago and is published on Google Play. It was made in JAVA, but now the version is depreciated on the market. What I want for this app is to rewrite the code using Kotlin or Flutter, because this app was made in Java 4 years ago. Within the app it has many functions. Apply for this project and tell me the price at which you would do it. and The estimated time. - Implement in the app (Membership - payment plan with Google)
I am ...experienced professional to assist in importing the current version 4.11 of OpenShift Container Platform (OCP) cluster into a new Advanced Cluster Manager (ACM). - Task Details: - The project primarily entails the import of all resources and configurations from the current OCP cluster to the new ACM. - Once imported, the new ACM should only be accessible to selected users with Full Administrator rights. - Essential Skills: - Knowledge and proficiency in OpenShift Container Platform version 4.11. - Adequate understanding of Advanced Cluster Manager. - Familiarity with administration and user access management in an ACM environment. Please ensure to provide relevant experience and demonstrated ability with the requirements stated above before making...
I'm currently experiencing a peculiar issue on my CentOS server. The process /usr/sbin/mariadbd is showing 109% CPU usage in the WHM task manager, although the server load is stable and I haven't made any recent changes. Your primary task would be to diagnose and resolve this problem. No error messages or warning signs have appeared, making the source of the issue somewhat inscrutable. Access will be provided via AnyDesk or a remote desktop connection for swift and efficient troubleshooting. Your expertise in the following areas would be invaluable: - Proficiency in CentOS server administration - Expertise in WHM and server task management - Experience in identifying and resolving high CPU usage issues - Strong communication skills to work collaboratively and explain...
My WordPress website is redirecting to unknown sites and showing signs of injected Javascript. I've experienced this issue despite keeping my WordPress and plugins up to date. Key Requirements: - Identify the malware and its entry point - Remove all malware and traces of injected Javascript - Restore website to its original, clean state - Provide recommendations to prevent future attacks I have full access to my website's hosting environment. Ideal candidates should have proven experience in malware removal for WordPress sites and possess a strong understanding of web security best practices. Please share your approach and experience in your bid.
I'm looking for a proficient developer who can add a page to my website that interfaces smoothly with my MySQL database. The website already has formatting etc, so I'm not looking for that. The database stores a variety of exercise data, and the webpage needs to display this data in an intuitive and user-friendly manner. Key webpage features include: - Display of exercise data: Each exercise's description and its difficulty level should be displayed. There's also a column in the database containing YouTube URL links, so another important feature the webpage needs is the ability to watch these exercise videos directly from the webpage. It is a simple database with only one table. - Users should be able to select the exe...
I am looking for an expert Oracle DBA with experience in both Oracle RAC (Real Application Clusters) and standalone Oracle databases. The primary goal of this project is performance tuning. Ideal Skills and Experience: - Proven experience with Oracle RAC - Proven experience with standalone Oracle databases - Specialization in performance tuning - Familiarity with Oracle Database 19c Key Responsibilities: - Implementing performance tuning strategies - Monitoring and optimizing database performance - Troubleshooting issues related to performance - Ensuring the smooth operation of both RAC and standalone Oracle databases The ideal candidate should have a deep understanding of Oracle databases and be able to provide tailored solutions for enhancing performance on both O...
I'm seeking a seasoned developer well-versed in C# and Selenium to create a bot to facilitate automation on Facebook Marketplace. ...Marketplace Autopost Report & Status can be exported - You can search for Facebook groups based on keywords with the selected status of groups that are joined or already joined. For unjoined groups that we have searched for, you can auto join. - Can Auto Post to Facebook Group Each feature has Add, Filter, Combobox options, check, delete in the required places Create a License Key in Program For Access Application The ideal candidate for this job has prior experience developing bots for Facebook Marketplace and is proficient in C#, Selenium, SQLite, xpath and FB's API. They should also have a firm understanding of marketplace dynamics ...
Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.
There are 4 slots to be chosen according to the devices availability. Only 1 test case is allowed per participant. Must have access to ONE or all THREE of the following devices: Android mobile (Android 5 and above) iPhone (iOS 12.4 or later) Desktop/Laptop All required screenshots must be in the English language. All required screenshots must show the current time (using notification or taskbar).
...engaging, detailed biographies around net worth analysis. The articles will need to cover different individuals and their professional and personal journeys. Key requirements: - Ability to research and compile engaging biographical content - Experience in analyzing net worth, and presenting it in an accessible way - Strong writing skills, with the capacity to deliver both professional and personal tones - Quality sources to back up the net worth and biography analysis The ideal candidate will have a mix of a journalist's curiosity and a financial analyst's precision. This project will offer an opportunity to craft insightful pieces on successful individuals, and delve into the financial aspect of their lives. If you can combine storytelling with ...
I'm looking for a functional implementation utilizing AWS media convert in a .NET core environment, with a specific focus on video transcoding. - Functionalities: The main functionality to be implemented is video transcoding with the target being MP4 format. - Desired Output: The desired output resolution for the transcoded videos should be 1080p. Ideal Skills and Experience: - Significant experience with AWS Media Convert - Proficient in .NET core programming - Experience with video transcoding technologies - Understanding of video formats, particularly MP4, and resolution settings.
I'm in need of an experienced web developer to create an interactive multiple choice exam website. This platform is i...takers. These should be simple and easy to create, but also secure. - Comprehensive dashboard: Both users and admins should have access to a comprehensive dashboard for tracking user progress and other key performance metrics. Ideal Skills: - Proficiency in web development, particularly with creating interactive websites - Experience with user account management and authentication - Prior work with dashboard development and data visualization - A background in education or e-learning platforms would be a plus This project has a potential for further growth and development down the line, making it a great opportunity for a skilled developer loo...
I have a private football manager game online. Written in PHP and TWIG. The script has already been adapted to PHP 7 (from PHP 5). 1. Now it has been noticed that 1 function, 1 module does not work properly under PHP 7. Thi...under PHP 7. This module needs to be adjusted. 2. I need a few minor adjustments and functions in the game and in the admin area. 3. Then I would like to have a new module. A calendar where you can see the days and what matches you have on those days. (Read from the existing database and display). And with some functions. You have to know that every extension to this script will be written in modules. These are then copied into the directories and taken over by the main script. Who can help? Further information and sample images if you are intereste...
Need a solution A barcode app to print and track our inventory. (Barcode&QR desirable)Online - Webbased. ProductCode/SupplierCode/Category/SubCategory/Batch/Colour/Size/Expiry/Selling PriceA/X/X/X/X/X/XX/XX/XX...Webbased. ProductCode/SupplierCode/Category/SubCategory/Batch/Colour/Size/Expiry/Selling PriceA/X/X/X/X/X/XX/XX/XXXX/XXXXXX.00Item description must print on the lable More details: We wish to use this app to count our inventory using bar code scanners Also when items are placed in a box to transfer between two shops, we need it to be able to use the scanner and count accuracy. Is this project for business or personal use? For an existing business What information should successful freelancers include in their application? Experience How soon do you need your ...
...as well as a transition from a sidebar menu to a bottom menu. I'll provide examples of interfaces that I like, which I'd like you to incorporate into the design. I have a few specific layouts in mind that I'd like you to integrate into the new design. I will provide those examples of other apps and drawings to you. I will also give you access to the current assets we have for our mobile and desktop app now in Figma. The ideal candidate for this project would have: - Expertise in UI/UX design for both iOS and Android - Proficiency in Figma - A portfolio showcasing sleek, clean, and intuitive mobile app designs - Experience in advanced app design would be a plus I'd love to see how you can turn my vision into a visually appealing and user-friendly ...
...comprehensive warehouse inventory replenishment tracking system for our Fastener drawer at Home Depot. The system should have a focus on reporting and analytics, real-time bin shrink, and work with an electronic keypad and analog/digital interface. Key Features: - **Reporting and Analytics:** The system should provide insightful reports on inventory levels and trends. This will help us make data-driven decisions. - **Real-Time Bin Shrink:** I need to know if the quantity of items in the bin matches the recorded amount. - **Interface:** A mobile app interface will be ideal, making it easy for staff to work on the go. Inventory Tracking: - The system should involve manual entry for inventory tracking. The system should be user-friendly and easy to use for our staff. ...
I want a simple platform using APIs and web sockets to collect real time data and calculate the values and show in the form of heatmap using plotly heatmaps. I need 4 features. Liquidation heatmap, order book, net position heatmap and liquidation level. Please read attached requirements before sending a bid. And please quote actual amount
Integrated Al-Quran Education System Development Brief: Create a digital platform for Al-Quran education that features student progress tracking and transparent reporting. The system will utilize PHP Laravel, Flutter or .NET Core, with MySQL/MariaDB on a Linux server. Key Features: User registration for different roles: Admins, Teachers, Guardians, and Students. Payment options both online and offline. Attendance and performance monitoring tools. Video tutorials for Quranic concepts. Requirements: Experience in educational technology. Quick turnaround and budget adherence. Deliverables: Complete web application. User guide and maintenance support. Proposal Needs: Approach, timeline, and cost.
I need a comprehensive HTML/CSS solution for my report pages. it must be clean code with easy names class and id's not generated with ai Key Requirements: 5 pdf files not just this one . - Create inputs: I'm in need of a web developer to build inputs that can be used to create a real report. - Input types: The report inputs should include text, number, and date inputs, as well as checkboxes and tables. - Layout: The layout of the report pages should be exactly as shown in the sample page I will provide. Ideal skills for this job include: - Proficiency in HTML, CSS, and JavaScript. - Experience with form creation and layout design. - Attention to detail to ensure the layout is replicated accurately. i have x5 reports needed to be done not just this 3
...never been greater. Our project aims to revolutionize the traditional legal practice by creating a web-based platform that dematerializes legal processes, enabling seamless document exchange and teleconference appointments. Key Features: Document Exchange: Our platform provides a secure and user-friendly interface for clients and legal professionals to exchange documents swiftly and securely. Clients can upload documents, such as contracts, pleadings, and evidence, directly to their case file, eliminating the need for physical paperwork and reducing administrative burdens. Real-Time Case Updates: Clients can stay informed about the progress of their case through real-time updates and notifications. They can track milestones, receive alerts for upcoming deadlines, and access...
...controllers) from single code base 2. I want to learn a language in which we write a code once and can compile for any platform. 3. One possible answer to my questions is JavaScript. We can build server side apps in JS using Node.js & Next.js. Javascript can be embedded in HTML on client side too. We can build desktop apps in JS using Electron and we can make mobile apps in JS using react & angular. But in javascript will code be exactly same for all platforms ? 4. Another option is Flutter (Dart). 5. Which is better out of these 2 ? or can you suggest any other option apart of these 2 6. As of now I want to develop a web app for visual DBMS quite similar to ms access. It will look like a spreadsheet but will have capabilities of both Google sheets ...
I'm seeking a skilled microcontroller programmer for translating our control strategy into a code compatible with a dsPIC microcontroller. This code should be able to handle inputs of both voltage and current. The key features of this project include: 1. Control Strategy: Implementing a Proportional-Integral (PI) controller into the dsPIC microcontroller. 2. Input signals of the system include voltage and current. Being proficient in handling such systems is paramount. 3. Beyond written code, you should provide thoughtful documentation and comments so we can understand your strategies and algorithms. I am not specific about setpoints for voltage and current, so the approach should be adaptable. Ideal freelancers should possess the following skills and ex...
I'm seeking a talented video creator to produce 3 brief videos for a social media promotion. The ideal duration of each video should be around 30 seconds. Key requirements: - Video Duration: 30 seconds each - Total Videos: 3 - A sample video will be provided - Video should be animated character I'm looking to target the younger audience and garner their interest in the promotional content. The project is on a tight schedule, so I'm looking for a professional who can deliver these videos as soon as possible. Please keep in mind that the budget for this project is fixed, so no additional costs should be incurred. Ideal skills and experience: - Proven experience in creating engaging and professional social media video content - Ability to create con...
Confirmis () is a Singapore-based business information provider specializing in connecting businesses with global capabilities; comprised of industry veterans, Confirmis business model is designed to overcome perennial lack of data (let alone quality data) to support effective decision making, particularly in developing economies. As a Site Verifier, you will be responsible for verifying a company’s existence through visual data by conducting a site visit to ensure that we provide reliable and accurate information to our client. JOB DESCRIPTION: • Conduct basic verification with the subject company’s authorized representative, such as line of business, key executives' name, etc. • Take pictures of the subject company and its vicinity, as ...
Confirmis () is a Singapore-based business information provider specializing in connecting businesses with global capabilities; comprised of industry veterans, Confirmis business model is designed to overcome perennial lack of data (let alone quality data) to support effective decision making, particularly in developing economies. As a Site Verifier, you will be responsible for verifying a company’s existence through visual data by conducting a site visit to ensure that we provide reliable and accurate information to our client. JOB DESCRIPTION: • Conduct basic verification with the subject company’s authorized representative, such as line of business, key executives' name, etc. • Take pictures of the subject company and its vicinity, as ...
More details: What is the current DA (Domain Authority) and DR (Domain Rating) of your website? Above 30 Which strategies do you prefer I utilize to increase your DA and DR? Creating high-quality backlinks, Improving site content, Engaging more influential sites Are you willing to provide access to your website for on-page optimization? Yes
...types of cars are actually the combination of the following data: CarTypeId - Maker - Model - Year - RoofType Their relationship should be many-to-many, so we probably need a middle table that contains their combinations CarTypeId - ProductSKU The above is just a suggestion and additional columns or different implementations can be used. The plugin should implement the following: DATA Import: A way to import data from Excel file (example file attached). The import file might contain data for many SKUs and should overwrite the data of every specific SKU. As a result all the matching of Cars to SKUs is actually done in the Excel file. Products Filtering: Ability to filter the products that are matched to cars according to the cars (sample image ...
Deliver the fixed audio recording using the best technical software to achieve the best result
...of a crime, to the eventual match/no match on the DNA database. b. Identify any conditional aspects of the process, for example if there are any stages of the process where resources only become available once the previous sample has been processed. c. Second, write out the relevant equations associated with each step of the process, and construct a formula for the overall time in system. d. Use relevant notation and write out equations using Equation Editor in Word. e. Note – the rule of thumb is that any reader can pick up your report and replicate your results by following the methods. 2. Use mean values of each parameter to construct an “average” solution. a. Unit of interest – a DNA sample collected by a CSI. That is, each sample...
...reaching out through this email to make another request. In this case, we have a very important client here in Spain, operating in the online product sales sector, very similar to TEMU. They are interested in having us develop a community site, very much like the following example: EXAMPLE They want their community, which currently exists as a WhatsApp group, to have access to profiles where they can comment on products, engage in forums, and build communities. The functionality required is as follows: An internal client area providing information about the user's account (already created on () but requiring additional information specific to this platform). Image galleries and sliders. Social functions such as social media sharing buttons, activity feeds
...of the specific encryption standard used. Requirements: - Expertise in Laravel 6.0 - Experience with standard Laravel password hashing - Exceptional problem solving, particularly in cases with limited source information - Intermediate understanding of Laravel's native or custom password encryption standards beneficial. Backup files for the Laravel project are available. It is imperative to maintain the confidentiality of all information gained while working on this project. Note: all work must done via anydesk or teamviewer or other remote desktop...
I'm seeking a talented developer to create an application where users can upload video reels. I need an artificial intelligence feature integrated into the app that can analyze thes... The app will let users upload revision notes with a point system and have a dashboard of how long they've spent doing it. I want to eventually make it into an app which teachers, parents and students can use to check their childs activity and help others. i want a spot for brands to post student discounts and eventually earn commision off it the app sould also have a pro subscripion which has access to the good features. Ideal candidate should have: - Expertise in mobile app development - Experience with AI integration - Knowledge in video reel handling - Good understanding of text re...
I'm looking to restore certain webpages from the website that got impacted due to Google core updates in Mar'24. I want these webpages to be brought back to their former ranking on Google. I'm seeking an experienced SEO specialist who will suggest and implement ways to achieve this. -Beneficial skills: • Expert in SEO strategies with an understanding of Google's core updates • Capable of improving search engine ranking -Anticipated Outcomes: Restore the webpages back to their earlier google search rankings
...details before you bid Kindly bid if you are experienced in image editing...set in pixel -900 X 700+save to .png format and webp format The sample of the requirement is attached for your reference.... your quote will be considered for 1000 products images. All the images is for grocery shop 1) All products should be cropped individually from the brochure or image or website link, The same shall be shared to you as per the required data. Any visible imperfections need to be painstakingly cleared off. Each picture will have to be improved in terms of lighting and contrast to make it more visually appealing. 2) the Size of the image should be 900 X 700 (Sample attached for your reference) 3) No Duplicates images should be created even if the brochure /excel or image...
DESCRIPTION = = = = We need a skilled developer to create a mod for a future Minecraft SMP (Survival Multiplayer) server. The mod involves a small but crucial change to the game's hardcore aspect, allowing for easy toggling between hardcore mode and regular mode. PROJECT DETAILS = = = = - Objective: Modify Minecraft gameplay to toggle hardcore mode on and off seamlessly. - Functionality: When the hardcore mode is activated, players and those they kill are permanently put into spectator mode, except for using commands. - The toggle switch is in the form of 'canon off' and 'canon on' buttons, with 'on' activating the hardcore aspect. - All players should be able to toggle between modes without accessing creative mode. - Hardcore mode opera...
I am looking for an expert in Doorbird system to help maximize the efficiency of my home unit, focusing specifically on: Access control: - Enable the system to control multiple doors and garage openers - Allow to lock/unlock remotely - Add a keypad entry system for a streamlined user experience. Automation: - Automize processes where possible for ease of use Ideal Skills: - Extensive knowledge in Doorbird systems - Experience in automating security systems - Expertise in integrating varying access control systems, particularly with keypad entry systems and magnetic locks Your will help me document the current setup, explore technologies and products to purchase, make a plan incl. wire diagrams. Proven experience with home automation (doorbird a1018, doorbird D2101) ...
Seeking a highly skilled .Net Developer to upgrade the existing system's back-end, ensuring it's user-friendly and solid. Key requirements: - Enhance system navigation and ease of use. - Optimize system performance for heightened stability. - Bolster security features for increased protection. The revamped system should be able to integrate with current mobile applications seamlessly. While specific app functionalities have not been defined, the developer should have prior experience with real-time data synchronization, push notifications, and user authentication. In terms of project timeline, the expectation is for this to be completed within a month. Ideal Skills: - Extensive experience with .Net Development - Prior experience with system optimi...