Vb.net features punët
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
Hi, we need a c# .net/ maui package similar to with same functionality but with support for iOS in addition to existing platforms. Please don't ask for further details before you checked the package's page. Requirements: - the package must be able to Convert PDFs into images (save the whole pages to images, not just export existing images on pdf); - the package must provide iOS compatibility; - the package must provide a parameter to specify jpeg compression level and preserve colors; - the package must be developed in c#, compliant with .net/.net framework/Mono and ready to be used in windows/ maui ios & android projects; - the developer must provide c#, not hardcoded and fully commented source code;
User Authentication: User Interface: - Implement role-based access control to ensure that users only have access to features relevant to their roles within the company assigned by administrators and can view dashboards, Statistics and data access based on role privileges. Adaptive Employee Management: - Provide flexibility in employee profile fields, allowing administrators to customize add/remove fields such as contact information, job history based on the company's specific needs and Enable employees to update personal information like contact details or emergency contacts. - Store and organize employee documents, contracts, policies in database and Display for compliance purposes. Flexible Leave Management: - Allow administrators to configure various leave types such as ...
I need a Shopify website built for my physical products, similar to the layout and features of gymshark.com. Key Requirements: - Website should be designed with a focus on product categories and filtering options. - The design should be modern and visually appealing, with easy navigation and clear product presentation. Ideal Skills and Experience: - Proven experience in Shopify website development. - Familiarity with e-commerce best practices and trends. - Strong design skills, with the ability to create a visually appealing and user-friendly website. - Experience in implementing product categories and filtering options would be a plus.
I'm urgently looking for a highly skilled frontend developer for the creation of a professional dashboard. The dashboard must support both right-to-left and left-to-right languages and encompass a variety of features: • Data visualization: this is crucial for us to visually comprehend our information and data. • User management: we need this to streamline profile access, security, duties, etc. • Report generation: this feature should enable us to create comprehensive reports. • Graphs It is must be hight quality
I'm in need of a skilled Swift developer with experience in implementing in-app purchases in macOS applications. The application is already built and functioning, but I require assistance in adding a subscription-based in-app purchase feature. Key Requirements: - Have access to the Apple Developer Program and experience in submitting in-app purchase features to the Apple Store - Proficient in Swift, as the application is built using this language - Ability to implement subscription-based in-app purchases seamlessly - Experience in the development of macOS applications and complying with Apple Store guidelines Your responsibilities will include: - Implementing the subscription-based in-app purchase into the existing macOS application - Ensuring the in-app purchase feature is f...
I need a React Native developer to write a code that enables an uninstallation approval feature on both iOS and Android platforms. This feature should prompt a request for uninstallation permission whenever a user wants to uninstall the app. This request is sent to the admin for ap...or rejection. The entire approval process must be handled within the app itself. Key Competency Areas: - Proficiency in React Native development - Familiarity with iOS and Android platforms - Experience with creating in-app prompts and notifications - Ability to create admin-controlled features within an app - Strong attention to detail and quality of code. Please submit your bid along with any similar projects you've completed. Prior experience with similar features...
Seeking a skilled programmer adept in WordPress for custom coding work and form layout adjustments. Requires proficiency in backend management, specifically relating to data capture, viewing, and exporting in Excel format. A highlight of the project entails the customization of our existing WordPress theme and the integration of new, unspecified features. Lack of detailed request emphasizes the need for a freelancer capable of intuitive problem solving. Primary tasks include: - WordPress custom coding - PDF form adjustments - Data capture and export to Excel Ideal candidate should have knowledge and experience in custom coding, WordPress navigation, and form data handling. Exceptional problem-solving skills are highly appreciated. Undefined project elements call for a creative and...
I'm urgently requiring a resourceful developer to create a tailor-made HR dashboard for our company. The developer should ideally have extensive experience in HR dashboard creation and a strong understanding of HR-related metrics. Key Features: - The dashboard should prominently feature recruitment metrics and performance evaluations. Recruitment Metrics Include: - Time-to-hire - Cost-per-hire Performance Evaluations Indicators: - Retention rate The dashboard should present these metrics in a clear, accessible format, preferably utilizing visually-pleasing graphs and charts. To excel at this project, the developer should have significant experience working on similar projects, a keen eye for design, and a knack for turning complex data into easy-to-understand visuals. A t...
I am seeking a proficient PowerApps developer with notable experience in workflow automation, user-friendly interface design, and a background in Clinical Domain or Life Science would be beneficial. Key functionalities to be incorporated include: - Automation of complex workflows - Development of engaging and easy-to-navigate user interfaces - Incorporation of robust data visualization features - Seamless integration capabilities with other systems The successful application will cater to a micro team of 1-10 users. Freelancer should have a strong command of PowerApps, prior experience in the healthcare industry, and a portfolio showcasing relevant project experiences. Delivering on time while maintaining high-quality standards is essential. I look forward to working with a profe...
...appointment system, also known as telelegal and on-demand telelegal services, for individuals seeking legal advice and small businesses needing legal assistance. Hence, an understanding of how to design these features to cater to this specific audience would be beneficial. Our website services are primarily targeted at Lawyers, Chambers who needs Video call Consultancy Appointment System which is Known as Telelegal and On-demand Telelegal Service for individuals seeking legal advice and small businesses needing legal assistance. Hence, an understanding of how to design these features to cater to this specific audience would be beneficial....
I'm seeking an experienced content writer who has a deep understanding of the technology industry. The ideal candidate should be comfortable with complex technical information and be able to break it down into clear, digestible content for professionals in the field. Features of the work: - Required 10-15 blog post monthly - Blog posts writing tailored to industry professionals - Tight turnaround times - Consistent communication to ensure alignment Desired Skills: - Proven experience in technology-related writing - Ability to translate complex technical information into accessible content - Exceptional research abilities in the tech field - Understanding of blog post SEO strategies.
I'm seeking a proficient C# developer, skilled in the .NET framework for a project. The exact application type is still to be confirmed. You should have: - Strong experience with C# programming. - Understanding of .NET framework. - Ability to work without strict time constraints. Time frames and further project details will be discussed upon connection. Looking forward to working with a focused and motivated professional.
I'm in search of a qualified developer to create a sniper bot. This complex trading bot should ideally have the following features: -most important function is a sniper bot function with the ability to snipe the contract based on the wallet of the creator or a name used to deploy it. Example all the contracts that use the name PEPE will be bought instantly on presets values. and if i select the option to follow certain wallet will buy everything this wallet launches on - Automatic buy and sell orders: This bot should be able to place trades on my behalf, minimizing manual intervention. - Real-time blockchain analysis on the Solana network - Customizable alert system: I want to be alerted with all PNL data for every trade executed in real time after trade has completed.
I'm in search of a qualified developer to create a sniper bot. This complex trading bot should ideally have the following features: -most important function is a sniper bot function with the ability to snipe the contract based on the wallet of the creator or a name used to deploy it. Example all the contracts that use the name PEPE will be bought instantly on presets values. and if i select the option to follow certain wallet will buy everything this wallet launches on - Automatic buy and sell orders: This bot should be able to place trades on my behalf, minimizing manual intervention. - Real-time blockchain analysis on the Solana network - Customizable alert system: I want to be alerted with all PNL data for every trade executed in real time after trade has completed.
...developer with a keen eye for design and a knack for engaging content to revamp my outdated and unattractive website. The goal is to completely overhaul the site in terms of design, content, and features. Key Tasks: - **Design and Layout:** The current design is outdated and unattractive. I need a fresh, modern, and visually appealing layout. - **Content and Text:** The existing text needs to be rewritten, and new engaging content should be added. The goal is to make the site more compelling and user-friendly. - **Functionality and Features:** I'm looking for help in updating and adding new features to the website. This includes but is not limited to new images, videos, and pages or sections. Ideal Skills and Experience: - Proficiency in web development and ...
...as a service (SaaS). Our goal is to enhance customer support and engagement by incorporating multiple communication channels into a single, unified interface. **Key Integrations:** - **Messaging Platforms:** WhatsApp, Facebook Messenger, email, and SMS. Additionally, PBX system integration is required to bridge our voice call capabilities with digital communication channels. - **Features:** Essential features we're looking for include: - **File Sharing:** Ability to share documents, images, and videos across all channels. - **Chat History:** Seamless access to previous conversations for context and continuity in customer support. - **Chatbot Integration:** Capability to integrate AI chatbots for automated responses and assistance. **Ideal Skills and E...
I am looking for a talented developer to create an AI Resume builder that can support multiple formats and boasts several features. Specifications: - The program should support PDF and Word file formats. - The AI technology should be able to provide several functions: Selecting templates, generating content, and optimizing keywords. - The design of the generated resume should exude a creative flair. Ideal Candidate: - Strong knowledge in Artificial Intelligence. - Proven skills in software development, particularly in building tools with creative designs. - Experience with resume building is a big plus! Together we can empower individuals to create eye-catching resumes that stand out. Let's give job hunters the creative edge they need in their job search!
...website for professionals like me. The website will have a total of 6 pages, with no e-commerce features. The primary objective is to provide information to the visitors. The ideal freelancer for this job should have: - Proficiency in Framer and web design - Strong understanding of modern, clean design principles - Experience in creating UI/UX for professional audiences I have the rough layouts already and the content to be used. But you have to put it together in a beautiful looking website. Logo and color theme is also final. The website will have following pages: Home Page Mobile App - we have a mobile app on google play store, we want to give complete information about the app, key features, faqs, pricing, direct user to google play store. We will be launching t...
I'm looking for a professional with deep knowledge and experience in Drupal 10 and Microsoft 365 Suite (MS Forms, PowerApps, Power Automate, SharePoint Online). • Drupal 10 Services: The Drupal 10 project should include features like custom theme development, content management system, user registration and login, search functionality, and issue troubleshooting. - Theme Development: The custom theme should adhere strictly to our corporate branding guidelines and styleguides. • Microsoft 365 Services: The professional should also have expertise in MS Forms, PowerApps, Power Automate, SharePoint Online, and related M365 knowledge and competencies to ensure smooth operation of the systems. In total, this project will involve approximately 400 man-days of work, wit...
Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.
I'm struggling with the latest version of Evernote on my Mac. Can you help me with the following issues? - User Interface Changes: The new version has a different interface, which I'm finding confusing and disruptive to my workflow. - Syncing Issues: I'm having trouble syncing my notes across my devices. It's causing issues in terms of accessing a...devices. It's causing issues in terms of accessing and updating my data. - Note Organization Changes: The way notes are organized in the new version has also changed. I need assistance in understanding and adapting to this new system. I'm looking for someone who is experienced with Evernote, especially the latest Mac version. Your job would be to help me understand and effectively use the new features, as ...
Kami mencari programmer .NET dengan spesialisasi Blazor NET 8 dan diutamakan yang sudah familiar dengan Kendo UI dari Telerik. Di bayar berdasarkan satu project dengan term pembayaran sbb: Pembayaran 1: 20 persen (progress project 25%) Pembayaran 2: 25 persen (progress project 50%) Pembayaran 3: 20 persen (progress project 75%) Pembayaran 4: 25 persen (progress project 100%) Pembayaran Akhir: 10 persen (setelah UAT customer)
...The core functionality of the app should involve the following: - Image Recognition: The app should be able to accurately scan and recognize the text from the image of the additives list. - Text Analysis: Automatically provide the official and layman descriptions of all the additives. - Health Impact: The app should also have a feature that provides known health impacts of each additive. Key Features: - Cross-Platform: The app should be developed for both iOS and Android, ensuring a wider reach. - Minimalist Design: The user interface should be simple and minimalist to ensure ease of use and focus on core functionalities. - Basic Accuracy: While using the camera feature, the text recognition should provide basic accuracy for clear text. Your Role: - Develop a user-friendly, mi...
In need of a Minecraft enthusiast to create a lifesteal and bliss themed spawn for our server with a touch of SMP. The project requirements include: 1. Design Style: We want a spawn that captures the essence of lifesteal and bliss, t...inspiration from medieval, modern and fantasy themes. 2. PvP Arena: We require one PvP arena to be integrated into the spawn. It should also be a spectator-friendly space. 3. Crates and Keys: We would like an interesting mechanism for crates and keys to be a part of the spawn area. Ideal candidate would have experience designing minecraft spawns, particularly in integrating additional features like PvP arenas and crates mechanism. An understanding of SMP would be beneficial. A portfolio showcasing previous relevant work would be a decidi...
I need a robust StarCloud print feature integrated to my website through PHP. I require an expert in PHP who understands how to efficiently generate receipts directly from a website. Key Features Required: - Personalized receipt printing: Upon a successful order, a receipt should be generated for that specific transaction. - Simplified design: The receipt should be simple, uncluttered and easy to read. Please note, only the code is needed, no additional information like payment or customer details should be included. Ideal skills and experience: - PHP proficiency to ensure seamless integration - Familiarity with StarCloud system - Understanding of efficient coding practices for smooth running.
...with experience in Hubspot software development. The project will entail incorporating key features such as contact management, email marketing and lead generation into the Hubspot platform. Key requirements of the project include: - Integration of contact management feature to accurately store information. - Utilize the email marketing feature effectively for targeted campaigns. - Ensure the lead generation feature is robust and functional. In addition, the software should be compatible with key platforms and integrations like Salesforce, WordPress, and Shopify. Ideal candidates should have: - A profound understanding of Hubspot software. - Demonstrable experience in developing similar features. - A knack for integrating software with various platforms, particularly S...
Project Description: We are seeking a talented freelancer with expertise in graphic design and illustration to refine our marisco seafood restaurant logo concept. The current logo concept, attached for your review, features seafood elements arranged in an outer circle and a beach palm view in the center of an inner circle. However, we feel that the seafood elements appear too cartoonish and could benefit from a more realistic or less animated approach. Specifically, we envision the seafood elements to be depicted in a more authentic and refined manner, capturing the essence of quality and freshness. Additionally, the inner circle concept requires enhancement, with "MARISCOS" curving around the top section and "LA PLAYITA" curving around the bottom section. The...
I urgently need a mobile app for travel developed! - The app should be compatible for Android and iOS. - The main goal is to create a platform that supports travel-related services. - The exact features will be discussed later but they will likely include, but not be limited to, features like flight and hotel booking, city guides and maps, language translation and more. - Experience in e-commerce app development will be a plus, as this app will include booking and purchasing functionality. - Ideally, I'm looking for someone who has previously worked on similar travel apps. Please bid only if you can commit to a fast-track development process, as completion of the project is needed ASAP.
I'm in need of a talented 3D video animator who has a strong portfolio of realistic animations. The primary goal of the animation is to showcase my product or service to a young adult audience. Key requirements: - High-Quality Animation: The animation must be extremely detailed and realistic to appeal to young adults. - Showcase Product: The video should effectively display the key features of the product/service in an engaging manner. - Fast Turnaround: I'm looking for a freelancer who can deliver this project quickly without compromising the quality of the animation. Ideal Skills: - Prior Experience: Previous experience in creating realistic 3D animations for advertising purposes is a big plus. - Attention to Detail: A keen eye for detail and a commitment to delivering...
I am in need of a skilled professional who can convert my home design drawings into scale plans suitable for a county site plan. The purpose of this project is not ...- Building footprint - Setbacks from property lines - Drive - Easement road - Walkway - Existing trees as shown in the design - Septic tank Ideal Skills: - Strong understanding of scale plans and architectural drawings i.e. stetchup - Proficiency in using measurements and dimensions to create accurate scale designs - Ability to pay attention to detail and accurately incorporate all required features into the plan - Experience with county site plans would be beneficial but not mandatory. Please bid if you have the necessary skill set and experience to ensure this project is completed to a high standard and in a time...
I'm looking for a skilled developer to enhance the online appointment and payment system on my website. - **Current System**: We are currently using Fittlebug for our online appointment scheduling system. The new system will need to be compatible and integrated with this existing platform. - **Key Features**: We aim to incorporate the following features into the new system: - Real-time Availability: Customers should be able to see real-time availability and book accordingly. - Automatic Reminders: The system should automatically send reminders to customers before their appointment. - Payment Integration: The system should facilitate payment for appointments. - **Payment Integration Details**: Although we're considering integrating an online payment gateway ...
I need a comprehensive web and mobile application built. This project's goal is to manage service logistics from requesting to delivering. Some key features I need are: - User Management: Implementation of user registration/login, user roles, and permissions, and user profile management are essential. - Service Request Management: An efficient system for creating new service requests and assigning them to specific users or teams. Furthermore, being able to track the status and progress of these service requests is crucial. - Real-time Notifications: The applications should notify users in real-time as changes or updates are made. Advice on the best technologies to use for these functionalities is also needed. Ideal candidates for this job have experience building similar we...
I'm in need of an exceptionally experienced Unity Developer who can aid in crafting an action game for the PC platform. Key responsibilities will include: - Collaborating in the design & development of the game mechanics and user interface - Debugging and optimizing for compatibility and performance on PC - Implementing innovative and immersive gameplay features Ideal Candidate Skills: - Expertise in Unity game development - Proven history of developing action games - Strong grasp on C# and object-oriented programming - Familiarity with PC game development and compatibility optimization Applicants, please share your relevant portfolio pieces and prior experiences pertaining to action PC games development.
I'm seeking a social media expert who can assist in promoting crypto coin, which is currently in presale. Key Responsibilities: - Util...currently in presale. Key Responsibilities: - Utilize organic strategies to boost visibility of the coin on Facebook, Twitter, and Instagram. - Create and post informative content that raises awareness about the coin while maintaining authenticity and engagement levels. - Develop interactive polls and quizzes that encourage user participation, helping to create a buzz around the coin's unique features and benefits. I'm looking to strike a balance between informative posts and interactive content, and this role would suit someone with a good understanding of crypto and social media marketing. Experience in the promotion of simil...
I'm looking for an expert programmer proficient in Node, The bot was created to scrape coins from my Telegram group via API integration but currently, it isn't purchasing as expected. Specifically, I'd require someone who could: - Identify and fix the issues that prevent it from purchasing and selling the scraped coins. - Make sure the bot interacts pro...background in bot programming, API operations, web scraping, and experience dealing with cryptocurrency exchanges, particularly Latoken. Knowledge of crypto trading bots' operational peculiarities would be a major plus. Your task would be to get it back to working condition, ensuring all functions operate as they should. This job will evolve into continuous maintenance and development of bot's features. T...
NEEDS TO BE DONE IN 10 HOURS. I need a developer to create a Science Fiction Portal site using HTML, CSS, Javascript, PHP and MongoDB. The project has very tight time constraints, so I'm looking for someone who can work quickly and efficiently. Key Features: - Discussion Forums: The site must have an integrated forum for engaging discussions related to science fiction. - Movie and TV Show Reviews: Users should be able to rate, review and discuss science fiction movies and TV shows. Design Preferences: - I envision a minimalistic and modern design for the portal. The site should be clean, easy to navigate and visually appealing. Ideal Skills and Experience: - Proficiency in HTML, CSS, Javascript, PHP and MongoDB - Previous experience in developing forums and review systems ...
I need a developer to create a Science Fiction Portal site using HTML, CSS, Javascript, PHP and MongoDB. The project has very tight time constraints, so I'm looking for someone who can work quickly and efficiently. Key Features: - Discussion Forums: The site must have an integrated forum for engaging discussions related to science fiction. - Movie and TV Show Reviews: Users should be able to rate, review and discuss science fiction movies and TV shows. Design Preferences: - I envision a minimalistic and modern design for the portal. The site should be clean, easy to navigate and visually appealing. Ideal Skills and Experience: - Proficiency in HTML, CSS, Javascript, PHP and MongoDB - Previous experience in developing forums and review systems - Ability to work under tight de...
I'm seeking an experienced app developer who can assist me in enhancing existing features in my existing mobile application. It has been available on both IOS and Android for 4+ years, and I need the following enhancements: - Improve app’s existing feature set, to run as intended: The app has a few feature sets with inconsistencies or tend to be unreliable. Enhancements and overall App should be fine tuned for improved responsiveness, and a better customer experience. - Soften existing UI found within Communications: Modify the content being sent within email communications, with consistent interface populated with the appropriate details drawn from the App. - Admin Dashboard - surface additional details in the existing dashboard, that are already captured in the A...
I'm looking to create a custom CRM platform that leverages NFC card technology, and an accompanying iOS app. Here's a breakdown of the project's key components: - **NFC Card Interface Features:** - Payment Processing: Users should be able to make purchases directly through the interface - Access Control: Secure access to certain information or features based on user roles - Loyalty Program Management: Implement a loyalty program to incentivize user engagement - User Portfolio: Users should be able to customize their interface with links, contact information, and product displays - **iOS App Development:** I need an iOS app to complement the NFC interface and provide a seamless user experience across different platforms. Ideal candidates for...
...in modern architecture and have a keen eye for open floor plans. Key Points: - Short-Term Residential Design: My project is focused on a residential property that needs a fresh and modern design approach. - Modern Style: I'm particularly interested in a modern architectural aesthetic. It's crucial for the architect to have a good understanding of this style. - Open Floor Plan: One of the key features of this project is the implementation of an open floor plan. This should be a central consideration for the architect. Ideal Skills: - Experienced in Residential Architecture: Previous experience in residential design is highly preferred. - Proficient in Modern Architectural Styles: A strong understanding and experience with modern architectural styles is a must. - Skil...
I am in need of a proficient WordPress developer who can carry out effective content management for my website. Specifically, my website primarily features written blog posts. Your primary tasks would include: - Managing less than 10 pages or blog posts on a regular basis. - Updating the blog posts as necessary to create dynamic and attractive content. Ideal Skills and Experience: - In-depth understanding of WordPress and content management. - Proven experience working with written blog content management. - Exceptional attention to detail, ensuring cohesiveness and effectiveness in content presentation. - Excellent time management skills to ensure regular updates. This project center around content management, with keenness on frequency and quality of updates. Looking for a...
More details: What platforms would you like the auto-rickshaw booking app to be developed for? Both What specific features should be included in the app? Real-time tracking, Integrated payment system, User rating system Do you have any design preferences for the app? Minimalistic and clean We can book auto using mobile phone, online through web portal and kiosk in the exhibition.
I'm looking for a proficient programmer or web developer with experience in creating Chrome extensions for social media platforms. The main requirement is to generate tailored content for Instagram. - You should create a Chrome extension with the following features: - Template-based content generation: It should support text templates and also have the capability to overlay different texts over one video. - Text overlays: This feature is to add text over images or videos. - Mass production/download: This tool should generate content in bulk and allow for mass downloads. The ideal candidate for this project would have a strong command over JavaScript (for Chrome extension development) and experience dealing with various social media APIs. A strong understanding of content ...
Project Title: "Customer Order Management System" for an online retail business in MS Access. Objective: To develop a comprehensive database system that allows for efficient tracking and management of customer orders, inventory, and shipping. Key Features: 1. Customer Management - Store customer information including name, address, email, and phone number. - Track customer order history. - Customer feedback and preferences. 2. Inventory Management - Maintain a detailed list of products, including product ID, name, description, quantity in stock, and reorder levels. - Automated alerts for low stock levels. 3. Order Management - Enable creation of new orders with customer information, order details (product, quantity, price), and shipping method. - Trac...
...Role-playing game. I'm intrigued by games that captivate players, seizing their attention through immersive stories and dynamic, ever-changing worlds. Unfortunately, I skipped the question about game mechanics, but that gives an avenue for creativity. Here are the broad outlines of what I envision. Key Objectives: - Develop a PC game with a rich, Role-playing narrative. - Incorporate innovative features capturing imagination and interest. - Ensure responsiveness and high performance. - Provide post-development support for bug fixes and upgrades. Ideal Candidate: - Experience in PC game development, particularly in the RPG genre. - Ability to grasp concept and expand creatively on it. - Detail-oriented with a commitment to superior quality. - Understanding of best practic...
...for my business. Additionally, I am looking for a social media marketer who can help me effectively promote my products online. Key Requirements: - Website: The most important e-commerce features I'm looking for are a detailed product catalog, seamless shopping cart and checkout, and a customer review section. - Social Media Marketing: I need someone who's proficient in using social media as a marketing tool. This includes creating engaging content, managing ad campaigns and understanding analytics. Ideal Skills and Experience: - Proven experience in building e-commerce websites with a focus on the features mentioned above. - Solid understanding of e-commerce UI/UX principles. - A track record of successful social media marketing campaigns for e-commerce busin...