Pgp encryption vb script punët
fix a php/curl script - easy task
Pershendetje Ardi, jam duke kerkuar nje programer rreth nje pune ne php script a ka mundsi me kontaktu ne skype per me ta spjegu punen qe me duhet, pres pergjigje nga ju. Gjitha Tmirat.
Pershendetje A mundesh mema rregullu nje script per nje faqe wordpress? Per me shum mujm me fol ne chat.
I NEED A MLM WEBSITE IN PHP LANGUAGE LIKE THIS DEMO. CHECK THIS: USERID-admin PASSWORD-admin
I NEED A MLM WEBSITE DEVELOPED IN PHP LANGUAGE.... PLEASE CHECK THIS SITE FOR DEMO: USERID- admin PASSWORD- admin
Get me a WordPress theme detector script & install on my website. Script Must have all the functions like this one . I believe the script is available for free on github, I have the link..you have to test that & make necessary adjustment & make it work. let me know Thanks
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
...captivating content. - Audience: The channel is specifically targeted at young adults aged 18-34. I'd love to see how you've previously delivered appealing content to this age group. Ideal Skills: - Video Editing: Skilled in video editing software like Adobe Premiere Pro or Final Cut Pro. Enhancing visual aesthetics and ensuring smooth transitions will be key. - Creative Writing: The ability to script engaging content that appeals to a young demographic. - Social Media Management: Hands-on experience in managing YouTube channels, understanding algorithms and analytics. If you have previous experience in vlogging or lifestyle content creation, that’s a big plus. But ultimately, creativity and an understanding of what makes engaging content for young adults...
I'm looking to integrate Optical Character Recognition (OCR) into my web application. The primary goal is to automate data entry processes. The current application contains manual data entry. I am attaching a screenshot of how it is entered manually and a picture of the paper from which it is typed. OCR should be done automatically. We can take pictures with a mobile phone in a few ...Synchronization with the Computer The data can be immediately available on a computer via the web application or a specialized desktop application. Real-time synchronization can be achieved using technologies like WebSockets. Security and Authentication It is important to ensure the security of the application by using HTTPS protocol, user authentication (e.g., using JWT - JSON Web Tokens), and data ...
I'm looking for a skilled individual to design a PCB and program a chip for our RFID system. The focus of this project is on...- **Energy Efficiency Optimisation**: The system to be developed should be as power-efficient as possible. We need the RFID system to function optimally while conserving energy, ensuring long-term sustainability and performance. **Specifics of the Project**: The project is specifically for an RFID system, which comes with unique challenges and requirements. Since the system will not require encryption for secure data transmission, the focus is primarily on a strong wireless connection and energy efficiency. **Ideal Skills and Experience**: - PCB design - Chip programming - Wireless system design - Energy efficiency optimization - Previous experience ...
There are 89 simple phrases and the recording would take about 15 mins. the speakers need to be: - Native Italian speakers from Italy. - Age from 18-55. - Both professional voiceover or amateur Budget: $8 per speaker. We reserve the right to reject any recordings that do not meet our quality standards. (the pronunciation) Feel free to contact me if you are interested in this project. Best Regards Libby
I need a professional content creator skilled in human development to provide me with 30 video scripts and ideas for my business centered on getting rid of old block how nervous system control you, personal growth, overcoming fears, and building self-confidence. Each script should be educational and informative, while maintaining a concise length of 1-3 minutes. Key Requirements: - A solid understanding of human development, personal growth, and related topics - Proven experience in creating concise and engaging video scripts - Ability to convey complex information in an easy-to-understand manner - Strong writing skills with a focus on educational content - Previous experience with similar projects is highly preferred Your work will play a crucial role in helping individuals over...
I'm looking for a Unix shell scripting expert to help me with my project. Here's what's required: - Automating file transfers: I need a script that can download specific file types from a directory on my server and then upload them to an SFTP server. - Handling specific file types: The script needs to be able to recognize and transfer only files of specific types, rather than all files in the directory. Ideal skills and experience: - Proficiency in Unix shell scripting - Experience with SFTP - Expertise in handling specific file types in scripts - Familiarity with file transfer automation - Good communication and problem-solving skills If you feel you have the required skills and experience, please reach out. Thank you!
I am in need of skilled developers to build a cross-platform social networking app for both iOS and Android devices. The app main function will contribute to sparking discussions and interactions through cutting-edge features. Key Features: - User profiles to personali...real time content sharing and interactions. - End-to-end (E2E) conversations, facilitating encrypted and private conversations. Ideal developers for this project would have experience in building apps with similar features, fluent in cross-platform development and have a good understanding of user interface design. A strong background in data security would also be beneficial, given the E2E encryption requirement. Previous work in PPAR and live streaming feature integration would make you a standout candidate fo...
...Primary Features: - Timer scheduling - Remote control of ventilation systems - Monitoring parameters including temperature, humidity, twilight, and weather - Real-time notifications and alerts - Scheduling system actions - Support for multiple users simultaneously Given the sensitive nature of the data and operations, the application must be secure. Your work will involve implementing advanced encryption to safeguard our communications and data. The ideal candidate for this project should be proficient in mobile and desktop application development, with a deep understanding of systems' programming and security protocols. Knowledge of ventilation systems would be a plus. I encourage you to submit a proposal if you can deliver what I need and follow this with dedication and ...
I'm in immediate need of a skilled web developer to tweak an existing custom-built script for my car rental website. The script that I am using is this: I am looking for a professional with a high level of expertise in web development to make these adjustments quickly and effectively. The priority is the rapid completion of this project, so it is critical that the selected freelancer has the bandwidth to dedicate to this task immediately. Experience with custom-built scripts is a must. Your portfolio should demonstrate your capability to work on existing structures and adapt them to new requirements.
I am seeking an experienced Python developer to improve the functionality of a current script by adding new features, specifically automated tasks. The upgrades will involve: - Analysing and understanding the existing Python script. - Enhancing the script by adding automated task features to streamline operations. - Testing the script to ensure it performs as required with the new features. Ideal applicants will have: - Proficiency in Python, with a focus on script optimization. - Experience integrating automation functionalities into Python scripts. - A keen eye for detail and error detection. - A proven track record improving and maintaining Python script performance. I am looking forward to working with someone who can improve our script...
...into my project in full. I have integrated demo vesrion only. The primary goal is to improve the user experience by allowing for drag and drop functionality for file uploads. Key Requirements: - Implementation of drag and drop functionality using DropzoneJS - Ensuring DropzoneJS supports multiple file uploads at once - Do not need integration within the existing project structure. PHP Upload script working just fine. - Adherence to best practices for user interface design and user experience Ideal Skills and Experience: - Proficiency in JavaScript and relevant libraries, particularly DropzoneJS - Proven experience with front-end development and UI/UX design - Ability to integrate new functionalities to existing codebase Validation: - Start your quote with "Validation St...
...AFL that I need converted into TradingView Pine Script. The primary function of the current code is to execute trading decisions based on the conditions of the market. **** 1 MORE CONDITION TO BE ADDED MENTIONED IN TXT FILE ATTACHED******* ***** FIXED PRICE RS. 3000/- ONLY ******* Key requirements: - Conversion: The Amibroker AFL strategy needs to be converted to TradingView Pine Script. The converted script should retain the functionality and logic of the original. - Optimization: The Pine Script should be optimized for performance on the TradingView platform, ensuring efficient execution and minimal latency. - Strategy understanding: It's crucial that the freelancer understands the trading logic and conditions embedded in the Amibroker AFL script...
I have a 15-minute script in progress and I'm seeking a professional Turkish male voice-over artist to bring it to life. The project involves recording the script in a professional tone. Key requirements: - Male Turkish voice-over artist - Previous experience in long-form voice-over - Ability to deliver a professional tone - Strong communication skills I'd appreciate someone who can collaborate with me on this project, offering input on pacing and intonation where necessary. I'm looking for a voice that is clear, engaging, and professional. Please provide samples of previous work in your bid.
Hey you! Do you have more than 6 years as a Laravel Developer? Can you prove it? Can you prove/provide evidence of what you have personally done as a developer? Does compliance to high security standards, encyption at rest, encryption in transit, AES 256, SHA 256 mean something to you? Are you willing to join an existing project? Are you willing to work for a flat monthly salary? Then this job may be for you. Our team is hard at work building a web application. We currently need an additional developer to assist with some key activities. You will be assigned duties by our Application Team Leader. Shoot us a quick message if interested. No agencies or middle men please.
I am in need of expert skills in 2D animation to create a short, engaging video that encompasses a unique process. Requirements: - The animation should be 2D. - Experience with creating short, impactful animations is essential. - The completed video s...create a short, engaging video that encompasses a unique process. Requirements: - The animation should be 2D. - Experience with creating short, impactful animations is essential. - The completed video should be less than 1 minute in duration. - I will provide the script for the animation. - Grasp on translating text to visual imagery is invaluable. Ideal freelancers will possess exceptional 2D animation skills, strong communication, and an ability to work efficiently to create a punchy, less than a minute video from the provid...
I require a skilled 3D visual effects animator to create engaging rear projections ...particularly visual effects. - Ability to animate flying effects and magic effects. - Knowledge and experience in theater productions or similar events are a plus. - Strong understanding of timing and how visuals can enhance a live performance. Your task will be: - To design and animate distinctive 3D flying and magic effects. - To work with the director to ensure the visuals align with the script and the vision of the performance. - Be able to revise and refine animations upon review and feedback. Your goal is to create visual effects that will captivate the audience and enhance the overall experience of the theater production. I look forward to seeing your portfolio and discussing the projec...
Preciso de uma pessoa que faça a instalação e configuração de uma instância do Izing (Preferência pelo PRO com SaaS) ou Whaticket em uma VPS. O profissional deve possuir a expertise necessária para assegurar que não exista nenhum backdoor ou script malicioso no pacote usado para instalação. O pacote de instalação é de responsabilidade do profissional. Preciso das seguintes funcionalidades: • Suporte a API Wpp não oficial; • Chat multiusuário; • Transcrição de áudio • Configuração de chatbot com diversos fluxos; • API para disparo; Recursos que acho interessantes: • Suporte a API Wpp oficial; • Suporte a ...
...professional to assist with encryption and compression functionalities within my project. Key Requirements: - Task: The primary task is to implement encryption and decryption, along with compression and decompression, in the existing project. - Data: The encryption and decryption will primarily focus on text data. - Implementation: I specifically require the use of AES, Huffman, Inflate and Deflate, and GZIP mechanisms for the encryption and decryption process. Ideal Skills and Experience: - Extensive Experience: Strong experience with VB6, particularly in encryption, decryption, compression, and decompression. - Specific Knowledge: Proficiency in implementing AES, Huffman, Inflate and Deflate, and GZIP in VB6. - Industry Best Practices: Knowledge of...
...using GitHub Actions to automate testing and deployment. Cloudflare: Use Cloudflare for security (DDoS protection, WAF, SSL/TLS encryption), performance optimization (CDN, image optimization), and DNS management. 3. Specific Integrations or Third-Party Services OKTA: For secure tenant-based authentication and user management. GitHub: For version control and collaboration. DataStax Astra: Managed Cassandra database service for data storage. Netlify or Vercel: For hosting and deploying the frontend application. Monitoring and Logging: Prometheus and Grafana for monitoring. The ELK Stack for logging and analysis. Cloudflare: For DDoS protection, CDN, SSL/TLS encryption, load balancing, and traffic analytics. 4. Expected User Base and Their Needs User Base: The primary...
I am in need of a talented script writer who can create engaging, Hindi language horror scripts for YouTube. The scripts are for short films, with each video being less than 10 minutes. The focus of the horror should be more psychological thriller than supernatural or slasher. Key requirements for this project include: - Fluency in Hindi - Proven experience in scriptwriting, particularly for the horror genre - A deep understanding of the psychological thriller subgenre - An understanding of the dynamics of YouTube content and how to captivate an audience in a short span of time. The ideal candidate will be able to weave a compelling narrative that keeps viewers on the edge of their seats, all while maintaining a distinctly Hindi language and cultural context.
...working: VSL ad video that is working: Script for the ad: Script for the ad We want to use viral images to attract more people’s attention. Format: Beginning of the ad is a viral meme + cut to my recording + cut to body of the edited ad (old body that works) Beginning of the ad is a viral meme GC | Viral Memes + Middle of the ad is ME acting out something - “this might sound crazy but…” GC | Kim's Ad Footage + End of the ad is the original body of the video: - start from “this might sound crazy but..” GC | Adset 2 for Nick [Sprint 2] Video (raw) : Video (edited): Script for the ad: Script for the ad - for the subtitles The order of Reels I shot: Script: Reel:
i have Indicator tradingview code i need to fix the jason message to send alert in telegram group fit with cornix
I'm looking for a skilled developer to create a custom script for Jira Cloud. The script should modify the behavior of a select field within the platform. Key Features: - Dynamic Select Field: The select field should dynamically change based on the values chosen by other issues in the project. This means that as the field is selected, it should update to exclude values already in use by other issues. - Hide Values Already In Use: The script should ensure that the select field does not present options that have already been selected by other issues in the project. - Customize Form Behavior: The script should also allow for custom form behavior in Jira Cloud. This project requires a developer with experience in Jira Cloud and strong skills in Groovy, the r...
I'm looking for a talented native English speaker to paraphrase a script for a video. The script is intended for a general audience, so I need the content to engage and connect with viewers. The tone should be energetic. Key Requirements: - Native English speaker - Experience in script paraphrasing - Able to adapt content for a general audience - Capable of infusing an energetic tone - Understanding of video script writing nuances I'm looking for someone who can take my existing script and elevate it so it resonates with a wider audience. If you've got a great understanding of language, are creative, and can bring energy to your writing, this could be a perfect fit for you.
...on below terms as it is same for all of us, all team members. Use our projects to monetise your extra 4 hours a day, which were otherwise not making you anything. Work includes : 1. rebranding projects 2. upgrading dependecies to latest (which will again be useful in future projects done on same script) 3. smoothen flow and bug fixes to ensure all functions work perfectly (usually required in first project done on a particular script, which will again be used in future projects done on same script. We usually assign work on few particular scripts to each dev, so that this needs to be done minimum number of times). 4. Recurring projects based on expertise, and project flow (usually 1-5 projects per month per lancer depending on work quality, ethics, expertise and b...
I have a fairly complex Autohotkey script that customizes the behavior of an application. This script involves some advanced functions like Windows API calls and file manipulations, and I need it to be converted to C# code. The C# application doesn't need to have a GUI, it only needs to replicate the functionality of the Autohotkey script. API used - GetMenuItemCount EnableMenuItem GetMenuString Ahk method used MouseGetPos CoordMode WinExist WinGetClass LButton::return SendMessage WinGetTitle WinGet WinActivate ControlGetFocus Key requirements: - Convert an advanced Autohotkey script that customizes application behavior to C# code - Ensure the C# code replicates the original Autohotkey script's functionality - No GUI is required in the C# applic...
Write the script for mi insta reels based on the raw video provided to you. Script should sound genuine and engaging taking context from the provided video
...and the remaining balance available for future use. The deduction rate should be accurate, regardless of whether it's 0.5, 1, or 2 credits per minute. The system should automatically track and deduct credits based on the time spent in chat. In essence, the task will involve crafting a secure, easy-to-use, social networking text chat platform with added current-day features of Emoji Support and encryption....
I need software to automate the login process of a Windows Desktop Application (fill Username & PW). For that, i'm looking for either a consultant that can recommend/evaluate existing soft- and hardware, or a skilled developer to create a software/script for the task. The desired operation is as follows: User scans a finger. Based on the result, the username/PW fields are auto-filled and submitted. A UI to add/edit/delete users is obviously needed. Ideal Skills and Experience: - Proficiency in Windows application development and/or Windows scripting. - Experience with biometric fingerprint devices. - Experience in software automation. A proof of concept for the auto-fill part has already been tested and can be provided. A fingerprint scanner is already existing, if a so...
ALL PHP script of the configurations and parameters of the site /////CONFIG AND INSTALL SCRIPT //// I want a complete configuration of all parameters URL DEMO SCRIPT. 7437.Cj0KCQiA5rGuBhCnARIsAN11vgR0IAOeV3fZLehJ28mJeOVeC35qXrrXFJfbYhlUK8e9nraqPybSIxUaAic2EALw_wcB .................................................. ................ ......... I want a complete script setup with all systems working. CREATION OF ACCOUNTS AND EMAIL ADDRESSES TO MAKE THE WHOLE SCRIPT WORK example add: :add languages EUROPE AND ENGLISH : account creation, facebock, instagram, twitter X, (create an email address on the domain)
We're looking for someone to qualify leads and set appointments with interested parties for our web based 3D virtual floorplan software. We'll initia...afterwards we'll look at paying you for a set number of hours as milestones. We currently have hundreds of contact details which need to be worked. Competitive rates will be prioritised. Skills needed: Good conversational English Preferably neutral accent Ability to evangelise a product Competent with telephone sales Duties include: Cold calling from a spreadsheet of prospects Work using a script as guidelines Pitching our product to prospects over the phone Conversationally move a prospect to a booked meeting with our Sales Director There is also commission available which will be discussed after the trial per...
LegalSearch aims to be an artificial intelligence-based application that enables effective search and analysis of legal decisions. This application aims to provide users with fast and accurate access to information in lega...most current and reliable information through continuously updated databases. Technology and Infrastructure: Artificial Intelligence: Develops an AI-powered search engine using OpenAI's GPT model. Cloud Infrastructure: Runs on cloud-based services for fast and reliable access. Web-based Application: Provides access through a user-friendly interface via web browsers. Security: Utilizes strong encryption methods for user data privacy and security. Target Audience: Law firms and lawyers. Law school students and academics. Anyone involved in legal decision-ma...
...have the latest software installed and updated. - Secure Environment Expectations: - I expect our overall environment to be top-notch in terms of security. This will involve implementing effective intrusion detection, utilizing strong data encryption practices, and managing access control. Your service should also extend to addressing day-to-day IT issues promptly. Ideal candidates should have: - Proven experience in Cyber Security and IT services - Strong background in security management, including Intrusion Detection and Data Encryption - Expertise in handling IT service requests efficiently - Previous experience in managing firewall and conducting vulnerability assessments - Ability to handle Penetration Testing and VAPT. Your team will be instrumental in...
I'm seeking a proficient developer with a strong background in Android app development. This application is designed for working professionals, so understanding the needs and wants of this demographic is highly desirable. The functionalities required for this app include: - Login/Register: I need a secure login and registration system. This will require a user database and password encryption. Please note, the application will be in English only, so a strong working proficiency in English is crucial. A perfect fit would be someone who has prior experience in projects with similar requirements. Your portfolio showcasing your previous work with mobile authentication systems would strengthen your application.
...expert mobile developer to build an event app for both iOS and Android platforms. The application will primarily function as an event hub and needs to incorporate a number of advanced features. The app must support: - Event registration - Agenda scheduling - Push notifications - Selling different priced tickets per seat/location - country of the event and more - API integration with website (php script built with laravel) A similar app will be provided for reference. The ideal candidate should have solid experience in implementing these features and a strong understanding of both platforms. Being able to create a user friendly and smooth interface is essential. Knowledge of ticket sale systems and push notifications will put you at an advantage in the application process. Pl...
...candidate applications based on predefined criteria and job requirements. • Use machine learning classifiers to filter and rank candidates, reducing manual effort and time spent by recruiters in the initial screening process. 8. Data Security and Privacy: • Implement robust data security measures to protect user data and ensure compliance with data protection regulations such as GDPR. • Utilize encryption techniques for securing sensitive information such as user credentials, resumes, and personal data stored in the database. 8.1. Performance and Scalability: • Design the system architecture to be scalable and capable of handling a large volume of users and job listings. • Utilize cloud infrastructure services such as AWS or Azure for scalable hosting a...
...etc. Platform and Device Support: - The CRM should be accessible through web browsers, desktop applications, and mobile apps. Seamless integration across these platforms is crucial for our team's efficiency and flexibility. Data Security Measures: - User Authentication: The system should only grant access to authorized personnel, ensuring the confidentiality and integrity of our data. - Data Encryption: All sensitive data within the system should be encrypted, preventing unauthorized access and potential data breaches. - Access Control: The CRM should have robust access control features, allowing us to control who can view and edit specific data, safeguarding against internal threats. The ideal candidate for this project should have extensive experience in CRM system deve...
I need assistance with extracting specific data from a voter list that comes in PDF format from the election commission. Here’s what I need: - Extract Name, FathersName, Age, Gender, VoterID, and SerialNumber from the PDF voter list. - Placement in a standard Excel format is acceptable, no need for any specific formatting. - Not just a one-time service, I also need a software or script that can perform this PDF-to-Excel conversion automatically in the future. Ideal candidates for this project have advanced skills in data extraction, familiarity with handling election data and proficiency in developing an automated system for convenient PDF to Excel conversion.
I'm looking for a skilled developer to help integ...**Websockets Integration**: The project primarily requires the integration of Websockets to enable real-time updates. The financial data should be updated swiftly and accurately as it changes. - **Data Security**: While the data is sensitive, standard encryption is sufficient. The system should be safeguarded against any data breaches that would compromise the financial data. Ideal Skills: - Proficiency in Websockets and real-time data updates. - Experience in handling financial data or other similarly sensitive information. - Understanding of encryption methods and how to apply them effectively to secure data. The successful freelancer will ensure that the system is fast, secure, and that the data is updated in real-...
I need a 30-second video explainer in Hindi, targeted at adult viewers, that explains the features of a product. The script is ready. However, I need an AI-generated realistic avatar to be the primary character in the video. Key Project Details: - Video length: 30 seconds - Language: Hindi - Target Audience: Adults - Avatar Style: Realistic Requirements: - Proficient in creating animated video explainers - Experience with AI-generated avatars - Skilled in producing content in Hindi Please include relevant samples of your previous work in your proposal.
Ideal Skills and Experience: - Proficient in C# programming language and .NET framework - Experience in developing desktop applications - Familiarity with Visual Studio - Ability to implement data encryption and database integration - Expertise in developing secure user authentication mechanisms Please provide relevant examples of your previous work in C# desktop application development.