Vb net chat punët
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
Ideal Skills and Experience: - Proficient in C# programming language and .NET framework - Experience in developing desktop applications - Familiarity with Visual Studio - Ability to implement data encryption and database integration - Expertise in developing secure user authentication mechanisms Please provide relevant examples of your previous work in C# desktop application development.
I need a professional website that aptly portrays my investment advisory services and showcases my portfolio. The website should cater to individual investors, small business owners, and high-net-worth individuals. Key Features: - Detailed and clear information about my advisory services: Candidates with experience in creating informative and engaging content relating to finance or investments will have an advantage. - An investment portfolio section: The ideal freelancer should demonstrate an ability to elegantly display financial data in an accessible manner. - A contact form: Allow visitors to submit inquiries directly through the site. - An investment calculator: This needs to be user-friendly and visually appealing, requiring both frontend and backend capabilities. Ideal...
...accessories field. If you have the creativity and skills to bring fresh ideas and elegant solutions, please send us your portfolio. Let’s create something amazing together! This project involves Arabic-inspired products. Based in Kuwait ?? Thanks Plz read carefully before replying , your 1st understanding of the project will effect my decision..! Attached suggested logo and some references from the net .. regards...
I'm looking for a professional to help me in developing a mobile app for WhatsApp chat handling. The app will be used for managing and responding to incoming messages. Key Points: - The primary task of this project is creating a mobile application that will enable me to manage WhatsApp messages efficiently. - The app doesn't need to automate replies based on keywords - I will be sending manual replies only. - The app needs to have an easy-to-use interface for message management. Ideal Skills and Experience: - Proficiency in mobile app development, particularly for iOS and Android. - Prior experience with chat-based applications or messaging platforms. - Strong understanding of WhatsApp's API and its integration into mobile apps. - Ability to design user-frie...
I'm l...outreach, and connections to identify suitable candidates. - Running Portfolios: Coordinate the portfolios of these individuals, tracking their performance and making strategic adjustments as needed. - Generating Portfolios via Events: Plan and execute events that attract potential club presidents and generate new portfolios. The ideal candidate should have: - Proven experience in sourcing high-net-worth individuals - An existing network in the business and finance world - Strong project management skills, especially in portfolio management - Excellent communication and negotiation skills This project will be handled collaboratively, so I'm looking for someone who can bring creativity and strategic vision to the table. Please provide details of your relevant expe...
Trabalhar em atendimento home office em central de marcação de consultas
Objetivo: Un sistema que permita a los estudiantes publicar sus tareas o exámenes universitarios a través de un formulario general. En cuestión de minutos, los tutores/profesores activos recibiran la orden y podrán ofrecerse para resolverlos, pujando con un precio. El estudiante tendrá la libertad de elegir al tutor que considere más adecuado para su trabajo mediante la negociación a través de un chat en tiempo real. Video demostrativo: Porfavor mira este video de 2 minutos para entender este proyecto, se solicita uno similar ? FUNCIONES DEL SISTEMA: de Estudiante: Registro y Perfil: Los estudiantes podrán crear una cuenta con sus datos personales y académicos, incluyendo su institución
I'm looking to sales of my digital product on Gumroad through chat platforms. The ideal freelancer should have: - Proven experience in digital marketing, especially in selling digital products. - Proficiency in using chat platforms for sales, ideally with a focus on Gumroad. - Strong communication skills and ability to engage potential customers effectively.
My project requires an experienced programmer who has the technical abilities to modify an XSL style sheet and adjust its layout. The task will specifically focus on: - Changing the layout of the style sheet and VB code. This modification is needed to appropriately accommodate some new fields that have been added to an import file. - Improving the style sheet so as to automatically map the new fields from the import file. The ideal candidate for this job should have experience with layout adjustments in XSL style sheets, automatic mapping of new fields and VB coding. Your skills and experience in rearranging content layout, updating fonts & colors, and altering data display formats will be highly appreciated. Don't hesitate to place your bid if you can deliver t...
I'm in need of an experienced web developer with strong shell scripting skills. While the main purpose of the website application is not specified, it's targeted at the general public. Ideal Skills and Experience: - Proven expertise in web application development - Experience in creating websites geared towards the general public - Robust skills in shell scripting - Ability to independently make decisions to enhance website functionalities Note: As the tasks for shell scripting are undefined, a flexible way of working is preferred for meeting emergent needs in the project.
I'm looking to have a chat feature added to my online tutoring platform to facilitate both one-on-one and group conversations between tutors and students. The primary purpose of this chat function is for instant messaging. Key Features Needed: - Instant Messaging: A real-time chat functionality that allows tutors and students to communicate seamlessly. - Group Conversations: The chat should support group conversations as well as one-on-one chats. - Message Read Receipts: The ability for users to know if their message has been read by the recipient. - Typing Indicators: This feature will show when the other person is typing to enhance real-time communication. - Offline Messaging Capability: The chat should allow users to send messages even when the r...
Basically we are dealers in computers and cctv cameras I am looking for a website, only one messaging bar center of website once client sent message from that message, the same I have to receive on my whatsapp message and then we can continue chat in whatsapp only, basiclly I want my clients to forward to whatsapp chat and a nice bakcground image of all computers parts and cctv parts image One logo of my company name with images of computers brand
I have a frontend project built using React and Mobx. The main focus of this project is to clean up the code structure while enhancing the performance of the app. Understanding of .net would be a great plus. Key requirements: 1. **Code Structure Cleanup:** The existing code structure needs to be reorganized and optimized to ensure it's well-maintained and scalable in the future. 2. **Performance Improvement:** The main goal of this cleanup is to enhance the performance of the app. This might involve identifying and removing any redundant code, refactoring certain functions, or optimizing data flow. 3. **Coding Standards:** While there are no strict coding standards in place currently, I'm open to suggestions on implementing best practices. The chosen freelancer should b...
I am looking for a proficient C# developer who can build a .Net 8 Console application with in-depth CSV handling capabilities. You will need to be able to: - Import CSV files; - Validate CSV data, specifically focusing on data format and range checks; - Convert validated CSV data to a c# DTO format; - Post the converted data to an API. Responding to errors is a significant part of the project. The application should be able to handle any issues encountered during the import, validation, or conversion processes seamlessly. Proficiency in C# is a core necessity, with previous experience in CSV handling and data validation highly desired.
I'm searching for a highly proficient .NET developer with a strong background in .NET Framework. The scope of this project involves: - Developing a multifaceted data management system for optimal organization and analysis - Creating a robust e-commerce system to drive online sales - Designing a custom application per specified functionality needs The ideal candidate should demonstrate an in-depth understanding of C#, with significant experience applying it within the realm of .NET Framework. Your portfolio should exhibit your versatility in leveraging the .NET Framework for a range of use-cases with a focus on data management, e-commerce solutions, and custom app development.
...award it to another developer. To qualify you must be full stack and conde in . , .NET ASP WEB API + MS SQL Details of our current project STACK can be seen here -> Prerequisites: For this optimization task you can bid your normal hourly rate but for the long term project the starting wage will be as stated below. 1) Accept initial hourly rate of U$5.00 2) Accept and start work immediatly 3) Have MINIMUM OF 20+ hours a week for long term ongoing support and development. 4) If you are awarded the project accept IMMEDIATELY 5) Work hours: predominantly 20:00 to 02:00 (UTC -3 Brazil TIME) 6) Be available to work on weekends. Our projects use: GITLAB -> , ag-grid, C#, .NET API, MS SQL 2017 , WooCommerce digital product sales This is for ongoing long term deve...
I need an experienced Maui/Xamarin programmer who can write a native code helper to access(CRUD) the notes field of a selected contact in contacts/phonebook. Primarily for Android bu need to do same on iOS. Therefore programmer needs familiarity with within .net Maui project targetting Android iOs 1) Android code helper 'getnotes(contactid)', returning the notes field of the selected contact Id 'savenotes(contactid,newnote)', posts edited/new notes to notes field of contact Id 2) ditto for iOs Note Maui has an interface to both iOs and Android phoebook/contacts. It does not however offer access to Notes field - therefore this has to be done using native code. In Android my preference is to use a Contentresolver.
.NET API to check for misconfiguration in AD CS.
I'm seeking a skilled full stack developer to help with a web application project that I'm working on. The ideal candidate should be proficient in JavaScript and .NET, with specific experience in Angular and SQL Server. Key Skills and Experience: - Proficiency in JavaScript and .NET. - Strong knowledge of Angular and SQL Server. - Previous experience in developing web applications. - Ability to work collaboratively in a team setting. Responsibilities: - Develop the front-end using Angular. - Design and maintain the back-end of the application using .NET. - Ensure seamless integration of SQL Server for database management. - Conduct thorough testing to guarantee the application's functionality. This is a great opportunity for a skilled full stack devel...
I need a .NET software developer to work on a project for me urgently. Key Responsibilities: - Your main task will be software development. I need a professional who can create efficient and high-quality software for my project. Skills & Experience: - Proficiency in ASP.NET, Entity Framework, and Windows Forms is crucial. - Prior experience with similar projects or a portfolio demonstrating your capability in software development would be a bonus. The project is time-sensitive, so I need it completed ASAP. If you're a .NET expert who can hit the ground running on software development, I'd love to hear from you.
I am currently facing a fairly serious issue with my dot net software - it crashes habitually, specifically when performing a certain function or operation. This has proven to be a major nuisance and has hampered my tasks significantly. Key Objectives: - Discover the root cause of the crashes - Implement a robust and permanent solution to prevent future crashes This project calls for a seasoned dot net developer who has extensive experience with troubleshooting and issue-resolution. Having a strong background in software maintenance and optimization is a definite plus. The ideal candidate will possess: - Experience fixing crash issues with dot net software - Ability to work methodically to identify the source of the issue - Exceptional problem-solving capability ...
I'm in need of a mobile chat application development, with specific functionalities that cater to my needs. Interested freelancers should have a vast understanding of mobile chat app development, and a keen attention to detail. Here are the key features needed: - Group Chats: The application should support communication among a group of people. A solid grasp on managing larger group dynamics within chat applications would be beneficial. - Emoji Support: The application should support the use of emojis for enhanced and fun interaction. Prior experience integrating emojis into mobile applications is highly preferred. Overall, this is a project that requires a specialised set of skills in mobile app chat development, experience in group chat dynamic...
...seeking the expertise of a seasoned developer to create a customized chat functionality for a project I'm currently running. After careful consideration, I've decided to focus on group text chat as the core communication channel. Here's what I'm envisioning: - Group Messaging: The core communication method in use will be group messages. I want the developer to build a robust system where users can create, engage, and manage group chats efficiently. Experience in building similar platforms will be a significant advantage. - Media Sharing: The chat interface should be modern and dynamic, capable of handling in-message media sharing. This means users should be able to share images, videos, and other rich media content within the chat conve...
I’m looking for an individual with a strong intermediate knowledge level of .NET to conduct training for a small group of 1 to 10 people. Here are the key details about the training to be conducted: - This role requires someone experienced with .NET Core and ASP.NET. Your primary focus will be these areas and you should be able to deliver training effectively on this. - As a trainer, you would need to have an excellent command of these concepts and the ability to explain them in a way that's easy for the participants to understand. - Previous experience with delivering .NET training is a significant plus. 1 day physially training for MIS level audience. location at Bandar Sri Damansara.
necesito una app ya sea en VB code o inventor que lea en tiempo real 3 sensores calor corporal, ritmo cardiaco y estres, se necesita lo mas rapido posible.
necesito una app ya sea en VB code o inventor que lea en tiempo real 3 sensores calor corporal, ritmo cardiaco y estres, se necesita lo mas rapido posible.
...developer who can work with Visual Basic and/or .NET to create an application with the following requirements: Backend Functionality: - User Authentication: Develop a secure and efficient user authentication system. - Database Integration: Implement a database management system to store and retrieve data. - API Integration: Integrate external APIs to enhance the application’s functionality. Frontend Development: - Develop an intuitive and user-friendly interface for the application. - Ensure that the frontend interacts seamlessly with the backend. Deployment: - Once the development work is complete, you will be responsible for uploading the application to the server of our choice. Ideal Skills and Experience: - Proficiency in Visual Basic and/or .NET - Experience...
I'm looking for a UI designer to create a user experience that's specifically tailored for high net worth individuals. The project involves designing for both mobile (iOS, Android) and web platforms. Key Project Points: **Enhancing User Experience:** The primary goal of this project is to make navigation and interaction as intuitive and user-friendly as possible for such HNIs. **Multi-Platform Design:** The user interface should be consistent and optimized for both mobile (iOS, Android) and web platforms. Experience in responsive design is a must. For the phase 1, below are the requirements: $$ The application caters to investors / high net worth individuals, who want to invest in startups. Below 3 screens are expected: 1. On the homepage, there will be li...
I'm in need of a skilled .Net 8.0 expert to help me fix a Google OAuth issue. The issue lies in the fact that I cannot authenticate users through Google's OAuth system. The primary purpose of this application is user authentication. Ideal candidate for the task should have the following skills and experience: - Proficiency in .NET 8.0 - Extensive experience working with Google OAuth - Strong problem-solving skills - A focus on clean code and system performance - An understanding of user authentication systems. Candidate must have experience with ServiceStack. Please explain what service stack is in the application. Issue needs to be sorted in 48 hours.
Sistema de gestión odontológica que tiene módulos de Login y seguridad, gestión de roles y permisos, ingreso de pacientes, ingreso de doctores, ingreso de servicios radiográficos, pagos de los servicios, reportes y gestión de los servicios radiográficos, se debe realizar en Net 6 u 8, Angular, Postgresql
I need a professional IT specialist resume writer. This resume will need to highlight my expertise as a FrontEnd webdevelopment proficient in Angular and .net. Key points: - You will need to have experience in IT resume writing. - The resume should focus on my skills as a FrontEnd webdevelopment. - Proficiency in Angular and .net should be highlighted. - The resume should get more than 95 score on jobscan. Skills Required
I need a professional IT specialist resume writer. This resume will need to highlight my expertise as a Full Stack Developer proficient in Angular and .net. Key points: - You will need to have experience in IT resume writing. - The resume should focus on my skills as a Full Stack Developer. - Proficiency in Angular and .net should be highlighted. - The resume should get more than 95 score on jobscan.
We are the largest and fastest growing UK charity community delivering support through multiple services via our website. Our website and AI machine learning and GPT are handled by others. We need dev support for the core SQL system and 2 small SQL directories, plus running reports and system admin. We need full stack Microsoft .NET development experience, strong SQL knowledge and exposure to Azure Microsoft services. We require a range of services. We’ll begin with the ad hoc work to begin to build a working relationship and then build that up to the following on an ongoing basis. • Ad hoc tasks for minor tweaks and changes on an ongoing basis. • Larger pieces of work, such as creating a moving from a free to a free and premium versions, with upgrading our He...
I'm looking to have a chat feature added to my online tutoring platform to facilitate both one-on-one and group conversations between tutors and students. The primary purpose of this chat function is for instant messaging. Key Features Needed: - Instant Messaging: A real-time chat functionality that allows tutors and students to communicate seamlessly. - Group Conversations: The chat should support group conversations as well as one-on-one chats. - Message Read Receipts: The ability for users to know if their message has been read by the recipient. - Typing Indicators: This feature will show when the other person is typing to enhance real-time communication. - Offline Messaging Capability: The chat should allow users to send messages even when the r...
I'm in need of a Figma designer to create a chat room that is specifically tailored for mobile use. The primary aim of this chat room is to facilitate social interaction amongst users. Key Features: - Photo and video sharing capabilities - Integration of emojis, stickers and gifs Ideal candidates for this project should have: - Proficiency in Figma and mobile design - A strong background in user experience and user interface design - Previous experience with chat room applications would be a plus The final design should be intuitive, engaging, and optimized for smooth operation on both iOS and Android devices. If this project aligns with your expertise, I'd be keen to hear from you.
I'm in need of a talented Keycloak software developer with a solid grasp of .NET. The primary goal of this project will be to develop a custom user management and authorization system. Key Responsibilities: - Create a custom user management and authorization system using Keycloak - Implement role-based access control - Develop user registration and profile management features - Integrate the solution with our existing user database The ideal candidate for this project would have: - Proficiency in Keycloak - Extensive experience with .NET - A strong understanding of user management systems and implementing role-based access control - Previous experience integrating user databases List of views: - Login - Users - App roles - User groups Development for User Management...
...Services for NLP and machine learning Additional Features * Support for multiple languages and locales * Customizable user interface and branding * Integration with other Microsoft tools and services (e.g., Office, Azure) * Security and compliance features (e.g., encryption, access controls) On-Prem Client: * Quivr Agent * Programming Language: C# or C++ * Framework: Windows Desktop (.NET Framework or .NET Core) or macOS (Xamarin or macOS SDK) * Database: Azure Storage or Microsoft SQL Server (local instance) * File System: Windows File System or macOS File System * Networking: HTTPS (TLS 1.2 or later) * Installation: Windows Installer (MSI) or macOS Installer (PKG) * GitHub Solution: * Local Data Storage * Azure Storage (Blob Storage or F...
...this, I am seeking a highly skilled professional to help me reinstall the system and rectify all the problems at hand. The job involves the following steps: 1) Change the OS from Linux to Windows Server 2016 or Higher (This may cause the data to be erased. In this case use the copy of the site and reinstall 2) Download Windows Server 2016 II, Office 2019, , .NET Framework 4.7 or 4.8, Visual FoxPro 9 Executable. And it should be Configured to the present environment. 3) In the first menu of , there is a function “Chemplan Online”. Chemplan database and EXE are residing at the server, this should be connected to the online function discussed above . 4) Chemplan and all its functionality should be tested and should
I am looking for an individual or a business with a strong network of high net worth individuals and/or family offices that would be willing to introduce me to and help me pitch to them an Accountancy Practice Roll-Up project I am running and requires funding. I am looking to raise £500,000 in equity in rounds 1 and 2, within 3-9 months time. The payment will be as a percentage of the funds raised successfully for the project through this person or company. It will have to be equity participation. Loans are not considered at this stage. - Strong Network: Leveraging your connections to high net worth individuals is crucial. I need to tap into your relationships to pitch my business concept. - Industry Experience: Having a background in raising funds for roll ups, s...
...hosted by a web host. Our customers send orders electronically in EDIFACT format. These orders contain an order number, different delivery points, each of which has its own GLN (customer number), different items and the quantities of the items. There must be a way for the operator to independently create items that can be ordered. These items always have an EAN number, a product name and a net price. Net price is the price without VAT. The orders should appear in a list. When our employee calls up this list, he can see these complete orders and then decide whether he wants to process individual orders or all of them together. This should be done using a checkbox. Click on checkboxes for individual orders and if you click on a checkbox, all checkboxes for all orders wi...
...Openswoole developer to create a live chat system with specific functionalities. The main aspects of this project include: - Real-time Communication: The core of this project is to develop a live chat system utilizing Openswoole to ensure seamless and real-time communication between users. - Platform Compatibility: The widget needs to be compatible with WordPress, Shopify, and Wix. - Easy Embedding: The widget should be easily embeddable on various websites to ensure a smooth integration process. - Customizable Design: I require the widget to be customizable. - Key Functionalities: The live chat feature should include file sharing and chat history. The ideal candidate for this project should have strong expertise in Openswoole, PHP, and live chat ...
...high-performance APIs and programs using C#, .NET Core based on architecture frameworks and guidelines Prepare API Collection and Documentation Collaborate with external and internal teams to test and troubleshoot performance and functional issues Work towards DevOps model for continuous integration (CI) and continuous delivery/deployment (CD) pipelines Technical Skills: API developers should have comprehensive technical skills, including the following: Ability to work on protocols like HTTP, FTP and Web Sockets Ability to create APIs using REST pattern Knowledge of GraphQL and gRPC is an added advantage Knowledge of Web Services and understanding of service-oriented architecture (SOA) Proficiency with common API development frameworks/tools, including .NET Core 6+, MS ...
I'm looking to integrate a real-time chat feature between our CRM (Bitrix24) and Omnichannel (Huggy) platforms. Key details include: - The integration must be comprehensive, i.e., there should be no missing features or functionalities on either platform during or after integration. - Real-time synchronization is crucial. This means that chat data should be immediately accessible and updated in both systems without delay. Ideal candidates for this job should have prior experience in real-time chat integration, especially with CRM and Omnichannel platforms. They should be able to deliver quality work that guarantees seamless communication without any glitches or delays in the chat feature. I appreciate developers who pay attention to details, as every aspec...
El puesto de perfil de ventas a través de chat con horario intermitente durante todo el día implica un compromiso completo con la satisfacción del cliente y la maximización de las ventas. Como representante de ventas en línea, serás el rostro amigable y perspicaz de la empresa, interactuando con clientes potenciales y existentes a través de plataformas de chat en vivo. Tu misión principal será entender las necesidades y deseos del cliente, ofreciendo soluciones personalizadas y productos que satisfagan sus requerimientos. Este rol requiere habilidades excepcionales de comunicación escrita, así como una comprensión profunda de los productos o servicios ofrecidos. Debes ser capaz de construir r...
...bringing to mind an image of dependability and expertise in wealth management Domain name availability: ".com" Domain should be available Ideal Skills and Experience of branding person: - Expertise in marketing and branding - Familiar with wealth management industry - Background in finance or related fields Responsibilities: - Create a brand name for Mobile Application that appeals to high net worth individuals - It must be original and memorable - The name should be short and should be easy to remember - It should reflect positivity and no negativity Industry: Financial planning, Wealth management, Investments, Insurance, Retirement, etc. Ultimately, I am aiming for a brand name that effectively reaches the sophisticated audience, and encapsulates the high lev...
In search of a skillful developer to create a real-time chat feature for a mobile application. The main functionality should include: - Real-time messaging capability There is no urgency in completion timeline, so we value quality over speed in delivery. Ideal candidates for this project should have prior experience in building chat features for mobile apps. Proficiency in real-time communications and knowledge of cloud messaging APIs will be valuable as well. Candidates who have a good understanding of latest trends in mobile chat interfaces will be preferred. Let's build a chat experience that truly engages users.