Gridview vb net sorting punët

Filtër

Kërkimet e mia të fundit
Filtro sipas:
Buxheti
deri në
deri në
deri në
Lloji
Aftёsitё
Gjuhët
    Shteti i punës
    2,000 gridview vb net sorting punët e gjetura, me çmimin EUR
    Programing Ka përfunduar left

    Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc

    €11120 (Avg Bid)
    €11120 Oferta mesatare
    4 ofertat
    Crie um Website Ka përfunduar left

    Desenvolvedor .NET MVC, SQL e ADVPL Protheus

    €2700 (Avg Bid)
    €2700 Oferta mesatare
    1 ofertat
    qefqreqweqawdafsc Ka përfunduar left

    asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr

    €182 (Avg Bid)
    €182 Oferta mesatare
    1 ofertat
    yveguwvcjnjnecbkhb Ka përfunduar left

    ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif

    €104 (Avg Bid)
    €104 Oferta mesatare
    1 ofertat

    I'm in search of a skilled .Net mobile developer to finalize my .Net Maui mobile application. The key tasks include: - Implementing the logic, specifically around user interface interactions. - Although user authentication, data synchronization, and push notifications were not explicitly mentioned, familiarity with these aspects would be advantageous for potential troubleshooting or further development. The mobile application is already well underway, with views, and a nearly finalized backend. Therefore, I need a freelancer who is proficient in both .Net and Maui and can confidently complete the application. Ideal skills and experience: - Proficiency in .Net and Maui - Experience in mobile application development - Understanding of user interface intera...

    €161 (Avg Bid)
    €161 Oferta mesatare
    17 ofertat

    ...performance improvements. - Regular software updates and security patches. - Feature additions and enhancements. Skills and Experience: - Proven experience in maintaining e-commerce solutions. - Proficiency in React, Node.js, Python, and MySQL. - Strong problem-solving skills. - Excellent understanding of software best practices and design patterns. - Ability to work independently and meet deadlines. - .NET and are a plus but not a requirement. Prerequisites: For the long term project the *STARTING* wage will be as stated below. 1) Accept initial hourly rate of U$5.00 2) If awarded, accept and start work IMMEDIATELY 3) Have MINIMUM OF 20+ hours a week for long term ongoing support and development. 4) Work hours: predominantly 20:00 to 02:00 (UTC -3 Brazil TIME) 5) Be availabl...

    €6 / hr (Avg Bid)
    €6 / hr Oferta mesatare
    34 ofertat

    I am in search of a skilled .NET Core developer to work on a project for me. As the client, I'm looking for someone who can bring the following to the table: - Proficiency in .NET Core: Given that my project is based on this technology, familiarity and experience with it is a must. - Application Development Experience: Previous experience in developing web applications would be particularly beneficial. - Strong Problem-Solving Skills: The ability to troubleshoot issues and devise solutions is key. - Attention to Detail: It's important that our project is implemented correctly and accurately. The ideal candidate for this project would be someone who understands the nuances of .NET Core, has a good track record in application development, and can work efficie...

    €30 (Avg Bid)
    €30 Oferta mesatare
    1 ofertat

    I am in need of a developer skilled in Flutter to create a hybrid app for both iOS and Android platforms. The primary function of this app will be able to support reading manga. Key deliverables for this project include: - Development of a user-friendly application in Flutter. - The app needs to be capable of uploading, sorting and categorizing manga content. - Any experience with manga or comic book applications is a bonus, but not necessary. Proven experience in Flutter and mobile application development for both iOS and Android platforms is required. A successful candidate should demonstrate a strong understanding of usability and user experience and should be able to work effectively with minimal supervision. read this file for more details:

    €75 / hr (Avg Bid)
    €75 / hr Oferta mesatare
    48 ofertat
    Industrial Product Expert Needed 6 ditë left
    VERIFIKUAR

    I currently need an experienced industrial designer who can help me perfect a textile net for my product designed for basketball practice. Online, the main task will be to take the prototype of my existing product and make improvements through computing and then send it to be manufactured.

    €121 (Avg Bid)
    €121 Oferta mesatare
    31 ofertat

    I am seeking an experienced developer to integrate an open-source search function, like Elastic Search or Solr, into my application. The app's search utility must be optimized to suggest...items. - It will focus on product search within the application. - The search results need to be sorted by relevance for better user preferences. Ideal Skills and Experience: - Proven track record of implementing and optimizing search functions. - Strong knowledge of open-source search utilities like Elastic Search or Solr. - Familiarity with product search algorithms. - Strong understanding of sorting functions, particularly by relevance. Your main task will be to integrate this search functionality seamlessly into the existing application, ensuring it works flawlessly and improves the u...

    €61 (Avg Bid)
    €61 Oferta mesatare
    7 ofertat

    Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.

    I cilësuar Urgjent MRS

    Full Stack .NET Core Developer Needed to develop our whats app api platform A basic requirement is that he has previously worked on the WhatsApp API platform. I can review it before starting work

    €247 (Avg Bid)
    €247 Oferta mesatare
    29 ofertat

    ...to publish reviews, ratings, and recommendations. 3. **Home Page and Navigation:** - Design a homepage that highlights top critics and their latest recommendations. - Facilitate easy navigation for general users to browse through critics and select their favorites. 4. **Critic Pages:** - Develop individual pages for each critic, showcasing their movie recommendations. - Implement sorting and filtering options for movies based on year, genre, and other criteria. **Challenges:** - Ensuring a seamless user experience for both critics and general users. - Maintaining the security and privacy of user data. - Handling and displaying large volumes of movie metadata efficiently. **Expected Outcome:** A functional and user-friendly website that empowers movie critics to sh...

    €168 (Avg Bid)
    €168 Oferta mesatare
    27 ofertat

    ...1) Linux staging server setup -> deploy our existing project to a new VPS using gitlab 2) Woocommerce -> continue long term development work on our existing custom plugin. Transfer the existing production woocommerce to this staging server. 3) ongoing long term development of our CRM app Other components of our stack which are a HUGE ADDED BENEFIT if you can work on them -> .NET ASP, WEB API + MS SQL DETAILS HERE -> PRIORITY IS TO HAVE A DEVELOPER ON OUR TEAM (LONG TERM) THAT CAN FOR NOW ALSO WORK WEEKENDS AS WE HAVE SEVERAL EMERGENCIES TO FINISH URGENTLY. Someone who can efficiently manage Linux VPS and efficiently use GITLAB is critical. Initially we need part of the hours to be worked in the first weeks from 8:00PM- 2:00am UTC -3 (Brazil Time)

    €8 / hr (Avg Bid)
    €8 / hr Oferta mesatare
    25 ofertat

    ...AS WE HAVE SEVERAL EMERGENCIES TO FINISH URGENTLY. We will start with 5-10 small task in and then go to some smaller .NET tasks all with 1 day sprints for you to become familiar with the software and then our main goal will be to integrate another B2B API for our MVNO. Initially we need part of the hours to be worked in the first weeks from 8:00PM- 2:00am UTC -3 (Brazil Time) later you can work on your time zone. If you are awarded the task we expect you to accept IMMEDIATELY and if the project is not accepted immediatly we will award it to another developer. To qualify you must be full stack and work PROFICIENTLY with gitlab and code in ., .NET ASP, WEB API + MS SQL. We also have woocommerce and have developed and will continue to develop plugins, so PHP and unders...

    €7 / hr (Avg Bid)
    €7 / hr Oferta mesatare
    30 ofertat

    I have a large set of data in Excel that requires thorough cleaning and organizing. - Tasks include: - Removing duplicates - Standardizing data formats - Data validation and verification - Identifying and correcting errors - Sorting and categorizing data Ideal Skills: - Proficiency in Excel or similar data management tools - Experience with data cleaning and organization - Strong attention to detail and accuracy The volume of data is significant, so I'm looking for someone who can work efficiently without compromising the quality of the work.

    €16 / hr (Avg Bid)
    €16 / hr Oferta mesatare
    62 ofertat

    I'm looking for an experienced Linux professional with a knack for data analysis to assist me with my projects. Ideally, you will possess: - In-depth knowledge and understanding of Linux as you will advise me on the suitable software to install for my tasks. - Experience dealing with numerical data. - Proficiency in data sorting, statistical analysis, and data visualization techniques as these will be a fundamental part of the job. In addition, knowing how to decode SecretKeys with the bs58 library is a crucial aspect of this project. This task represents a core operation you will be required to perform with the numerical data. Your ability to execute this function deftly will significantly impact the project's success. I am looking to begin the assignment as soon as I...

    €18 / hr (Avg Bid)
    €18 / hr Oferta mesatare
    17 ofertat

    I'm seeking a proficient developer to create a search engine for CommonCrawl.org. The primary goal of this project is to ensure better search accuracy through the implementation of advanced search filters and relevant sorting of search results. Key Responsibilities: - Develop a search engine with advanced search filters for enhanced user experience. - Implement relevant sorting of search results to enable users to easily find what they're looking for. - Ensure the search engine provides search results in both list view and grid view, offering users flexibility in how they interact with the data. Ideal Skills and Experience: - Proficient in web development and search engine implementation. - Strong understanding of data structuring and search algorithms. - Prior ex...

    €515 (Avg Bid)
    €515 Oferta mesatare
    78 ofertat
    Excel VBA Data Manipulation 6 ditë left
    VERIFIKUAR

    ... = True sheetxx(i).Select sheetxx(i).ChartObjects(1).Activate For Each objCht In fname1 & i & ".gif", "GIF" Next objCht Next i Key Requirements: - Manipulation of data: The main objective of this project is to create a script that will consistently and accurately manipulate data within my Excel sheets. This includes sorting, filtering, and performing calculations on the data. Ideal Candidate: - Proficient in VBA: The ideal candidate should possess advanced knowledge of Excel VBA, able to write clean, efficient, and error-free code that can handle large data sets. - Experience with Database Interactions: The VBA script will need to interact with databases, so any experience in this area will be highly beneficial.

    €26 (Avg Bid)
    €26 Oferta mesatare
    29 ofertat

    I'm looking for a skilled freelancer to develop a customized net worth spreadsheet. This spreadsheet should enable me to meticulously track my financial progress across various categories. Key Requirements: - The spreadsheet should allow me to input and monitor: - Investments (especially individual stocks) - Debt - Savings - Income - Expenses - Other category for miscellaneous expenses or income - I require a simple, user-friendly design that makes manual data entry easy and intuitive. Skills and Experience: - Proficiency in spreadsheet software such as Excel or Google Sheets is essential. - Experience in financial tracking and net worth management is highly beneficial. - Understanding of stock market, investment tracking, and basic accounting principle...

    €56 (Avg Bid)
    €56 Oferta mesatare
    16 ofertat

    As a business with a custom CRM solution currently facing some difficulties with Hubspot, I'm interes...more efficient and impactful. Ideal Skills and Experience: - Proficient in Hubspot: Experience with CRM management, data syncing, email automation, and reporting using Hubspot. - Strategic Thinker: Capable of analyzing current processes and suggesting and implementing improvements. - CRM Specialist: A background in CRM management and understanding of its intricacies. - Data Analyst: Capable of sorting through data discrepancies and creating a streamlined and accurate database. - Communication Skills: Ability to understand our needs and communicate effectively throughout the project. - Problem-Solver: A proactive approach to identifying and solving issues before they impact ...

    €18 / hr (Avg Bid)
    Urgjent
    €18 / hr Oferta mesatare
    38 ofertat

    I'm seeking to bring a remote administrative assistant on board for more than 20 hours a week to help me with various tasks. The ideal candidate should be proficient in Microsoft Office Suite and CRM software. Key Responsibilities: - Email Management: You'll be responsible for sorting, responding to, and organizing my emails. - Calendar Management: You'll be in charge of arranging meetings, appointments, and keeping my schedule up to date. - Data Entry: You'll assist in inputting and managing data. - Phone Calls: You'll also be expected to handle incoming calls and messages professionally. The successful candidate will have excellent communication skills and be able to work independently. Experience with Microsoft Office Suite and CRM software is a must...

    €10 / hr (Avg Bid)
    €10 / hr Oferta mesatare
    109 ofertat

    I'm seeking a detail-oriented freelancer for a text data entry project. The primary task is to input text data into a spreadsheet accurately. Additionally, these data must undergo sorting for seamless navigation and understanding. Key Responsibilities: - Text data entry into a spreadsheet - Implement effective sorting to organise the data Ideal Skills: - Proficient in Microsoft Excel - Strong attention to detail - Experience in data sorting techniques - Excellent typing skills The ideal candidate will possess a solid knowledge of Excel functionalities and data sorting. I look forward to connecting with passionate individuals eager to take on this task.

    €23 / hr (Avg Bid)
    €23 / hr Oferta mesatare
    60 ofertat

    Hello, I have my Python/Django site hosted on PythonAnywhere and it's facing a NET::ERR_CERT_DATE_INVALID issue. Website : I would appreciate someone help to troubleshoot this issue and fix the NET::ERR_CERT_DATE_INVALID error, ensuring that the SSL/TLS certificate is correctly set up. - Website troubleshooting and error resolution - SSL/TLS certificate configuration. Thanks in advance !

    €12 / hr (Avg Bid)
    €12 / hr Oferta mesatare
    21 ofertat

    I'm seeking an experienced DevOps engineer who is proficient in deploying React Frontend and .NET Core 8 applications to Alma Linux with NGinx server. The candidate should have solid experience with: - Deploying React FrontEnd and .NET Core 8 Web API applications on Alma Linux in GoDaddy VPS. - Knowledge of routing of both applications with one domain and one SSL. - Knowledge of handling SubDomain. - Knowledge of Alma Linux Nginx deployment. - Understanding of .NET Core Application Settings and React.JS application settings - Understanding of Node.JS

    €52 (Avg Bid)
    €52 Oferta mesatare
    13 ofertat
    LegalSearch 5 ditë left

    ...accurate and up-to-date information in the legal field. Assist legal professionals in their analytical work to form stronger legal arguments. Application Features: Text-based Search: Enables users to perform text-based searches within legal documents. AI-powered Search: Allows users to conduct more specific and comprehensive searches through integration with OpenAI's GPT model. Filtering and Sorting: Provides the ability to filter and sort search results by criteria such as date, file type, and court name. User Profile: Allows users to access their past searches and save favorite documents. Semantic Analysis: Capable of performing semantic analysis on texts to find similar decisions and content. Timeliness and Reliability: Provides users with access to the most current and ...

    €1197 (Avg Bid)
    €1197 Oferta mesatare
    44 ofertat

    I need a skilled .Net MAUI developer to assist me with my existing project. The main tasks for this project include: - Fixing bugs: The project is currently experiencing some issues which are negatively affecting the user experience. The specific bugs are not provided in this brief, but I can share details during our discussion. - App Publishing: Once the bugs are resolved, you will be responsible for publishing the updated version of the app to both Android and iOS stores. - Delivery of the final source code and making sure it is running on our machine. The ideal freelancer for this project should: - Have a proven track record in debugging and resolving issues in .Net MAUI projects. - Be proficient in the publishing process for both Android and iOS stores and should b...

    €180 (Avg Bid)
    €180 Oferta mesatare
    39 ofertat

    ...for relevant job openings. • Access to career advice, interview tips, and industry insights. 3.3 Employer Features: • Employers should be able to create and manage their company profiles. • Ability to post job listings, including job titles, descriptions, requirements, and application instructions. • Options to search and view job seeker profiles. • Tools for managing job applications include sorting, filtering, and communicating with applicants. • An analytics dashboard is used to track the performance of job postings and applicant metrics. 3.4 Communication Tools: • Integrated messaging system for communication between job seekers and employers. • Notifications for new messages, job applications, and other relevant updates. 3.5 Admin Pane...

    €697 (Avg Bid)
    €697 Oferta mesatare
    98 ofertat

    Ideal Skills and Experience: - Proficient in C# programming language and .NET framework - Experience in developing desktop applications - Familiarity with Visual Studio - Ability to implement data encryption and database integration - Expertise in developing secure user authentication mechanisms Please provide relevant examples of your previous work in C# desktop application development.

    €5 / hr (Avg Bid)
    €5 / hr Oferta mesatare
    25 ofertat

    I need a professional website that aptly portrays my investment advisory services and showcases my portfolio. The website should cater to individual investors, small business owners, and high-net-worth individuals. Key Features: - Detailed and clear information about my advisory services: Candidates with experience in creating informative and engaging content relating to finance or investments will have an advantage. - An investment portfolio section: The ideal freelancer should demonstrate an ability to elegantly display financial data in an accessible manner. - A contact form: Allow visitors to submit inquiries directly through the site. - An investment calculator: This needs to be user-friendly and visually appealing, requiring both frontend and backend capabilities. Ideal...

    €125 (Avg Bid)
    €125 Oferta mesatare
    21 ofertat

    ...accessories field. If you have the creativity and skills to bring fresh ideas and elegant solutions, please send us your portfolio. Let’s create something amazing together! This project involves Arabic-inspired products. Based in Kuwait ?? Thanks Plz read carefully before replying , your 1st understanding of the project will effect my decision..! Attached suggested logo and some references from the net .. regards...

    €194 (Avg Bid)
    €194 Oferta mesatare
    126 ofertat

    I'm l...outreach, and connections to identify suitable candidates. - Running Portfolios: Coordinate the portfolios of these individuals, tracking their performance and making strategic adjustments as needed. - Generating Portfolios via Events: Plan and execute events that attract potential club presidents and generate new portfolios. The ideal candidate should have: - Proven experience in sourcing high-net-worth individuals - An existing network in the business and finance world - Strong project management skills, especially in portfolio management - Excellent communication and negotiation skills This project will be handled collaboratively, so I'm looking for someone who can bring creativity and strategic vision to the table. Please provide details of your relevant expe...

    €18 - €154
    €18 - €154
    0 ofertat

    I need a skilled WordPress developer to list custom posts ...will appear on the users profile page which is set up in Each custom post already has a latitude and longitude as post meta using ACF. I just need help with extracting the latitude and longitude from the Google map in the user profile and sorting the posts according to distance from those coordinates. Ideal Skills and Experience: - Extensive experience with WordPress custom post types and custom fields. - Proficiency with Advanced Custom Fields (ACF) Google Map integration. - Prior experience implementing distance sorting on WordPress websites. This is an urgent project so I would require the task to be completed in a timely manner. If you have the skills and availability to get this done, please get in touch...

    €89 (Avg Bid)
    €89 Oferta mesatare
    46 ofertat

    I need a hand in mastering the use of MS Outlook. Specific tasks I require assistance with include: - Managing and organizing my contacts - Sorting and structuring my emails - Creating folders for better email management - Effective calendar management via Nextech EMR Moreover, I am unsure if linking Outlook to Teams or iCloud might boost my productivity. Hence, I need advice on possible integrations and synchronization with other platforms. The ideal bidder is proficient in MS Outlook, with experience in Teams or iCloud, and EMR systems, especially Nextech. Your ability to provide practical, simple solutions is highly valued. ( I WOULD NOT EXPECT MY TUTOR/ASSISTANT TO KNOW NEXTECH :) ) Completion of the project should ideally be within a month.

    €25 / hr (Avg Bid)
    €25 / hr Oferta mesatare
    10 ofertat

    I'm looking for a skilled web developer to create an e-commerce websit...seamless shopping experience for our customers. Key Features: - E-commerce Focus: The website will be the primary sales platform for the brand, so it must have all the functionality and design elements necessary for successful online selling. - Product Categorization: We sell both men's and women's clothing and accessories, so the website should have clear and distinct ways of presenting and sorting these categories. Payment Options: - Credit card - PayPal Ideal Skills and Experience: - Proven track record in developing e-commerce websites. - Strong understanding of UI/UX design principles. - Experience in implementing secure payment gateways. - Familiarity with designing for fashion or retai...

    €15 / hr (Avg Bid)
    €15 / hr Oferta mesatare
    222 ofertat
    Wordpress Plugin Gallery Adapter 4 ditë left
    VERIFIKUAR

    I have a WordPress plugin written in PHP that I need to adapt in order to create a gallery on a marketplace multivendor (Dokan). Key features include: - Each image in the gallery should have a different price - Ability to upload multiple images - Gallery display with sorting and filtering options I'm looking for a skilled WordPress plugin developer with experience in PHP and Dokan marketplace. The ideal candidate should have a strong background in creating and adapting WordPress plugins, as well as a solid understanding of e-commerce functionalities. Experience with Dokan would be a big plus.

    €34 (Avg Bid)
    €34 Oferta mesatare
    44 ofertat

    My project requires an experienced programmer who has the technical abilities to modify an XSL style sheet and adjust its layout. The task will specifically focus on: - Changing the layout of the style sheet and VB code. This modification is needed to appropriately accommodate some new fields that have been added to an import file. - Improving the style sheet so as to automatically map the new fields from the import file. The ideal candidate for this job should have experience with layout adjustments in XSL style sheets, automatic mapping of new fields and VB coding. Your skills and experience in rearranging content layout, updating fonts & colors, and altering data display formats will be highly appreciated. Don't hesitate to place your bid if you can deliver t...

    €129 (Avg Bid)
    Urgjent
    €129 Oferta mesatare
    26 ofertat

    Looking for a skilled developer to build a comprehensive contact management app for both iOS and Android platforms. This app should embody a minimalist and clean design, making it user-friendly and appealing to the eye. Key features that must be included are: - The ability to upload, categorize, and share there important contacts easily; users sh...contacts Based on categories we choose. - The users should be able to access their family network contacts for categorize life events for ease of use. Ideal applicants will have experience in app development for both platforms and an eye for clean, minimalistic design. Showcasing previous design work will considerably strengthen your application. Flair in developing convenient sharing features and sorting functionality will be highly ap...

    €2313 (Avg Bid)
    €2313 Oferta mesatare
    165 ofertat

    I'm in need of an experienced web developer with strong shell scripting skills. While the main purpose of the website application is not specified, it's targeted at the general public. Ideal Skills and Experience: - Proven expertise in web application development - Experience in creating websites geared towards the general public - Robust skills in shell scripting - Ability to independently make decisions to enhance website functionalities Note: As the tasks for shell scripting are undefined, a flexible way of working is preferred for meeting emergent needs in the project.

    €25 (Avg Bid)
    €25 Oferta mesatare
    23 ofertat

    I have a frontend project built using React and Mobx. The main focus of this project is to clean up the code structure while enhancing the performance of the app. Understanding of .net would be a great plus. Key requirements: 1. **Code Structure Cleanup:** The existing code structure needs to be reorganized and optimized to ensure it's well-maintained and scalable in the future. 2. **Performance Improvement:** The main goal of this cleanup is to enhance the performance of the app. This might involve identifying and removing any redundant code, refactoring certain functions, or optimizing data flow. 3. **Coding Standards:** While there are no strict coding standards in place currently, I'm open to suggestions on implementing best practices. The chosen freelancer should b...

    €433 (Avg Bid)
    €433 Oferta mesatare
    124 ofertat

    More details: Which version of Excel are you using? Excel 2016 What type of data processing do you need? Data sorting, Data filtering What specific criteria will you use for sorting the data? Numerical order It is required to set up a script that will process an Excel file every day, filter the file according to an algorithm and leave the necessary data in the file.

    €114 (Avg Bid)
    €114 Oferta mesatare
    99 ofertat
    Sortable Wordpress Users Page 4 ditë left
    VERIFIKUAR

    I need immediate help in adding sorting functionality to my Wordpress Users Page. Key Requirements: - The sorting should be based on user registration date. Experience/Skills Needed: - Strong proficiency in Wordpress - Prior experience with modifying Wordpress user pages - Ability to implement sorting functionality in a Wordpress environment

    €31 (Avg Bid)
    €31 Oferta mesatare
    77 ofertat

    I am looking for a proficient C# developer who can build a .Net 8 Console application with in-depth CSV handling capabilities. You will need to be able to: - Import CSV files; - Validate CSV data, specifically focusing on data format and range checks; - Convert validated CSV data to a c# DTO format; - Post the converted data to an API. Responding to errors is a significant part of the project. The application should be able to handle any issues encountered during the import, validation, or conversion processes seamlessly. Proficiency in C# is a core necessity, with previous experience in CSV handling and data validation highly desired.

    €141 (Avg Bid)
    Urgjent
    €141 Oferta mesatare
    36 ofertat

    I'm searching for a highly proficient .NET developer with a strong background in .NET Framework. The scope of this project involves: - Developing a multifaceted data management system for optimal organization and analysis - Creating a robust e-commerce system to drive online sales - Designing a custom application per specified functionality needs The ideal candidate should demonstrate an in-depth understanding of C#, with significant experience applying it within the realm of .NET Framework. Your portfolio should exhibit your versatility in leveraging the .NET Framework for a range of use-cases with a focus on data management, e-commerce solutions, and custom app development.

    €16 / hr (Avg Bid)
    €16 / hr Oferta mesatare
    11 ofertat

    ...award it to another developer. To qualify you must be full stack and conde in . , .NET ASP WEB API + MS SQL Details of our current project STACK can be seen here -> Prerequisites: For this optimization task you can bid your normal hourly rate but for the long term project the starting wage will be as stated below. 1) Accept initial hourly rate of U$5.00 2) Accept and start work immediatly 3) Have MINIMUM OF 20+ hours a week for long term ongoing support and development. 4) If you are awarded the project accept IMMEDIATELY 5) Work hours: predominantly 20:00 to 02:00 (UTC -3 Brazil TIME) 6) Be available to work on weekends. Our projects use: GITLAB -> , ag-grid, C#, .NET API, MS SQL 2017 , WooCommerce digital product sales This is for ongoing long term deve...

    €7 / hr (Avg Bid)
    €7 / hr Oferta mesatare
    48 ofertat

    I need an experienced Maui/Xamarin programmer who can write a native code helper to access(CRUD) the notes field of a selected contact in contacts/phonebook. Primarily for Android bu need to do same on iOS. Therefore programmer needs familiarity with within .net Maui project targetting Android iOs 1) Android code helper 'getnotes(contactid)', returning the notes field of the selected contact Id 'savenotes(contactid,newnote)', posts edited/new notes to notes field of contact Id 2) ditto for iOs Note Maui has an interface to both iOs and Android phoebook/contacts. It does not however offer access to Notes field - therefore this has to be done using native code. In Android my preference is to use a Contentresolver.

    €470 (Avg Bid)
    €470 Oferta mesatare
    37 ofertat

    .NET API to check for misconfiguration in AD CS.

    €460 (Avg Bid)
    €460 Oferta mesatare
    1 ofertat

    I'm seeking a skilled full stack developer to help with a web application project that I'm working on. The ideal candidate should be proficient in JavaScript and .NET, with specific experience in Angular and SQL Server. Key Skills and Experience: - Proficiency in JavaScript and .NET. - Strong knowledge of Angular and SQL Server. - Previous experience in developing web applications. - Ability to work collaboratively in a team setting. Responsibilities: - Develop the front-end using Angular. - Design and maintain the back-end of the application using .NET. - Ensure seamless integration of SQL Server for database management. - Conduct thorough testing to guarantee the application's functionality. This is a great opportunity for a skilled full stack devel...

    €895 (Avg Bid)
    €895 Oferta mesatare
    43 ofertat

    I need a .NET software developer to work on a project for me urgently. Key Responsibilities: - Your main task will be software development. I need a professional who can create efficient and high-quality software for my project. Skills & Experience: - Proficiency in ASP.NET, Entity Framework, and Windows Forms is crucial. - Prior experience with similar projects or a portfolio demonstrating your capability in software development would be a bonus. The project is time-sensitive, so I need it completed ASAP. If you're a .NET expert who can hit the ground running on software development, I'd love to hear from you.

    €177 (Avg Bid)
    €177 Oferta mesatare
    84 ofertat
    Dot Net sostware update 4 ditë left
    VERIFIKUAR

    I am currently facing a fairly serious issue with my dot net software - it crashes habitually, specifically when performing a certain function or operation. This has proven to be a major nuisance and has hampered my tasks significantly. Key Objectives: - Discover the root cause of the crashes - Implement a robust and permanent solution to prevent future crashes This project calls for a seasoned dot net developer who has extensive experience with troubleshooting and issue-resolution. Having a strong background in software maintenance and optimization is a definite plus. The ideal candidate will possess: - Experience fixing crash issues with dot net software - Ability to work methodically to identify the source of the issue - Exceptional problem-solving capability ...

    €64 (Avg Bid)
    €64 Oferta mesatare
    5 ofertat