How to store data in excel using vb net punët
Jam i gatshëm për të bërë gjithçka që punohet me Microsoft Office Excel...
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
hello sir mujhe job ki bhut zaroorat hai plz aap se request hai
See attachment. hfghjhgfghjhgfdsdgklkjhgfghjklknvbnmnbvcvbnm,.mnbvertyuytrertrghjugfdghjkjhgfdgkjhgfdfgjkjhg
i am a sudent.i want to wark my student life.i injey my hjdlky hg hjfdjk jfdyghure hjfdhuiirgjhfdjyuyrtjhugrhjreu utehgtyu teuhygkdfuurr hgruhdrjfhgtjhtghkjtguhfgj jtghjkkkkkkkkkkkkkkh
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
data entry kjhjkgkiugag jhgkugsdakfu sdfkjhjksg jfgjks jkgsfjkga sdfkjdg kjfhkj kjh jhf kfjhjn khk kjgugkn kjtgkjh jhtgiubh kjtguib tui ktiatu kjgijfuyt awefb kjguiasf kjghujf kjyuiyafn fuhiuyhfe flhkifdas ioyhuysdfn uiyuitydfn nawveen iujna jynarkujmar kumar kumar hjfhghghghgjhgjhgjhgjhgh
hrthrtehthtttfjirtjgiotjhthtihjitfklxmckfrgyt9jrlgmrlkhntih5hjfmsckfgt
Aklghgeklg'kgjrth;'hhj[hthihklgb[fg'gggh;f'hkgh'hnkgd;nlhndghnjhl;hhklghgfhhghhghhjgjhghjghjdfd'
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
need usd and oggfgsfdyioiuhytgfdsdfghjklkjhgfdsdfghjklkjhgvfcxzxcvbjkloi8765432qazxcvbhju76543wqazxcvbhju
need usd and oggfgsfdyioiuhytgfdsdfghjklkjhgfdsdfghjklkjhgvfcxzxcvbjkloi8765432qazxcvbhju76543wqazxcvbhju
i want to be data entry job use word, pdf , excel , PowerPoint , and any type of graphic design work . i have 3 years teaching experience with data collection , data entry , and graphics design . i have fully and wonderful experience in Microsoft office , excel, PowerPoint , photoshop , illustrator, CorelDRAW, filora
I am looking to develop a Variable Message Sign (VMS) software. The software should be: - Compatible with Windows - Able to facilitate message scheduling and display - Support remote management and control - Allow for advanced message customization - This SAAS (Software As a Service) based Software will be display a content publishing management system for PC, which is installed in the Windows operating system and allows editing solutions and playing the solutions on LCD or LED displays. - The software will be SAAS Based, On which multiple clients will be added, and the APIs of the device sold will be integrated into the Software. - This software will have a variety of media: you can add general windows, cut-to-display windows, Office documents, images, vid...
...developer to create a mobile application for both iOS and Android platforms. This application's primary function will be inventory management for a single store. Key Features Required: - Inventory tracking and management - Easy addition of products - Ability to categorize products - Alert notification for low stock - Detailed and customizable reporting feature Ideal Freelancer: - Experience in developing inventory management apps - Proficiency in iOS and Android app development - Familiarity with up-to-date inventory management techniques - Good organizational skills to ensure product categorization functionality - Strong attention to detail for developing customizable reporting feature - Excellent communication skills an...
...aiming to establish an online business, specifically an e-commerce store selling digital products. I'm seeking informed and skilled professionals to help design and implement my startup vision. Here's what I need: - E-commerce Website Design: Build a site tailored to digital product sales with modern UX/UI, optimized for conversions. - SEO and Digital Marketing: Optimize the site for search engines and plan a strong digital marketing strategy. - Integrations: Integrate needed third-party systems like payment processing, digital product delivery, etc. - Strategy: Provide advice and guidance for a successful e-commerce operation. Ideal candidates will have extensive experience in e-commerce site design, digital marketing, SEO, and business s...
I'm looking for a proficient Excel expert to regularly update and maintain our sales data. Key Responsibilities: - Update product details, sales quantities, and pricing information on a weekly basis - Ensure high accuracy and consistency in data entry - Identify any inconsistencies or data discrepancies and address them promptly Ideal Skills and Experience: - Proficiency in Excel, including advanced functions such as VLOOKUP and pivot tables - Strong attention to detail and data accuracy - Previous experience with e-commerce data management is a plus - Ability to work efficiently on a large volume of products (more than 500) Please note that the successful candidate will be someone who can commit ...
...concepts Translate technical requirements, develop application interface Manage time in a deadline-driven, team environment May supervise staff Perform other duties as assigned Skills Required Must be a U.S. Citizen Minimum 5-10 years experience Possess a solid understanding of object-oriented software Ability to learn desktop software development or web development technologies, tools and methodologies Possess a solid understanding of applicable development platforms such as Microsoft Stack or AWS Knowledge of building applications and user interfaces (e.g. Javascript, HTML/CSS, XML, C#, VBA and VB.NET) and/or databases (e.g. SQL) is desirable Proficient in all MS Office applications Demonstrated ability to creatively solve technical challenges Possess e...
For this project, we need to consolidate customer data from multiple Excel files into one Excel sheet using macros. This will allow us to manage our data more efficiently. Key tasks include: - Creating a macro that can extract and merge customer data across several Excel files. - Managing the data in a way that it is grouped by Customer ID. Skills and Experience: - Extensive knowledge in Excel and proficiency in creating macros. - Prior work experience with data consolidation projects. - Exceptional attention to detail. - Ability to organize data effectively. - Knowledge of data management according to customer demographics.
...need a professional Shopify developer to set up a multi-domain store, where I'll be selling the same 10 products on 3 different domains – .com, .in, and .ph. Each domain will cater to a different market, and I need the payment method to change accordingly. Key Responsibilities: - Set up 3 different domain stores using the same theme - About 10-12 products only - Implement payment method customization, reflecting the preferences of each target audience - Ensure that the store is fully functional and responsive Ideal Candidate: - Proven experience in building and customizing Shopify stores - Ability to handle multi-domain setups - Familiarity with payment gateway integrations - Strong attention to detail ...
...for a skilled data analyst to compile and analyze raw ad spend data from Google Ads and Facebook Ads. This data will be used in correlation with sales data from Excel Sheets. The goal of this task is to determine if the presented ad spend had a significant impact on total sales or sales in our stores. The data spans from May 2016 to May 2024. Key Requirements: - Compile ad spend data from Google Ads and Facebook Ads, and sales data from Excel Sheets. - Perform trend analysis on the data sets to determine if any discernable impact exists between the ad spend and sales. - The focus should be on whether ad spend, regardless of platform, led to a measurable and discer...
...iOS app developer to bring my e-commerce vision to life. Key Requirements: - App Purpose: The app will primarily serve as an e-commerce platform. - Platform: The development will be specifically for iOS. - Features: It should include product search and filtering functionality. Ideal Skills and Experience: - Proven experience in developing e-commerce platforms, particularly for iOS. - Strong knowledge of iOS development and the app store submission process. - Proficiency in creating intuitive and efficient product search and filtering systems. - A keen eye for UI/UX design to ensure a smooth and engaging shopping experience. - Excellent communication skills to keep me updated on project progress and seek feedback when necessary. If...
...and experienced C# developer with expertise in the .NET framework. The primary task at hand is to implement advanced background job features within the project, with a specific focus on Asynchronous Processing and Queue Management. Key Deliverables: - Implement Asynchronous Processing: The developer should be able to design and implement a system where tasks can be processed concurrently, allowing for better performance and resource utilization. - Implement Queue Management: The project requires a developer who can set up a robust queue management system, ensuring tasks are executed in the correct order and at the right time. Specific Requirements: - Maximum Queue Size: The system needs to be designed with scalability in mind. You sho...
I'm in need of a skilled developer who can build a .NET middle layer for me. This layer will be responsible for calling an external API and handling the responses in a JSON format. The requirement is to design the system in a way that the output is stored in a JSON file. Key Requirements: - Build a .NET middle layer for API calls - Handle API responses in JSON format - Save the output in a JSON file I need this layer to be manually triggered on-demand. This is a crucial aspect of the project, so reliability is key. Ideal Skills: - Proficiency in .NET development - Experience with APIs, especially handling JSON data - Ability to design systems for manual triggers Experience in...
I am looking for ready made chat application built in .net core. Only looking for ready made projects. Features- Edit message, Delete message, Create Group, Status... I need features which is available in google chat.
The Role: We are seeking an Application Developer to join our strong and growing Information Technology group at the California Association of REALTORS® (C.A.R.). This person will work in a team to design, develop, and support mission critical applications. The ideal candidate would be an expert in .NET MVC development using C#, and have experience developing and interfacing with SQL Server databases. The Application Developer creates, maintains, supports, extends and operates computer applications that serve the C.A.R. membership, the general public, and C.A.R. internal staff. The application portfolio is very broad ranging from communication tools to mobile applications, internal data processing applications, database applicat...
I'm looking for a talented mobile game developer to create a Sudoku game for both Android and iOS with a cartoon design style. This game will include levels of varying difficulties - easy, medium, and hard. Key Requirements: Develop a Sudoku game for Android and iOS using Unity. Implement intuitive touch controls and an attractive UI. Integrate features such as hints, difficulty levels, and score tracking. Ensure compatibility across various devices and screen sizes. Prepare the game for publishing on the Apple App Store and Google Play Store, meeting their respective guidelines and requirements. Deliver clean and well-organized code for easy maintenance and updates. Include social media sharing functionality for users to share their scores. Implem...
...e-commerce store for one of our sauce brands, Krowned Chef. Krowned Chef is an independent, family-owned retailer that supplies three main products: A peri-sauce, a chilli-sauce and an ayamase sauce (a nigerian stew). We have been serving direct to consumer for 2 years and are looking to improve our web presence. We’re looking to partner with a designer that can communicate what our brand stands for via a new website. Here are some bullet points that help describe our creative vision: - Our typical customer is female, aged 30+ and is Nigerian-born. - Our male customers are typically young dads or bachelors, who use our sauces as a shortcut to a hearty meal. - Some of our customers have found unique (and non-traditional) ways to use the s...
...am looking for help with a solidwork project. I want to build tuned pipe , expansion chamber for dirt bike. I do know all my dimensions lenght and diameters. I want to be able to draw a line wich will be my centerline and then on this line i want customize every lenght and diameter of each section. Then had radius in sections. I would like to to be able to divide each sections in strip section to be then cut on my plasma. I have included a YouTube video to show what i am looking for . I want to have a reference line that i can curve on every axis along the length required in order to follow the curved and straight section needed. - On that line I want to have adjustable point to ...
Need an android app to generate a pdf document. We have following fields to fill up and also et the end we need to be able to add a signature. - number - date - name - id series -id number - personal identification number - city - address - county - starting date - net income - gross income need to be able to generate pdf and also email option to send directly to email and print option
...looking for a skilled developer to update our Android platform APK for NFC access control on a custom-made board. Now we need to make it Cross platform and utilize the NFC CARD EMULATION system on the mobile device The Application is already developed and i have the source codes so i would like to work on it and not created from the scratch. The android version is located in the Andorid Store under the name of "PELEKIS NFC access control" Key Requirements: - The APK should be compatible with both Android and iOS platforms. - The main purpose of this APK is to facilitate NFC access control on a custom board, made specifically for this purpose. - The specific functionality required for this project is read/write capabilities. Ideal...
Translation of two files, from English to Hebrew. File #1 contains 8 rows of text in Excel format, 119 English words. File #2 contains 85 rows of text in Excel format, 2,035 English words.
I am looking for a React JS developer to help me create a feature-rich e-commerce website that includes API integration. Key Project Details: - The main purpose of the website is to serve as an E-commerce platform. - The project will require integration with the Phone Pe payment method. Ideal Skills and Experience: - Proficient in React JS for web development. - Experience in API integration, with a preference for integration with Phone Pe payment method. - Familiarity with e-commerce website development is preferred.
Service and ecom website need to built using html css js
I need a skilled developer with Opencart experience to create an automatic updater for my Opencart version 2.x store. The task is quite urgent, so I need it done as soon as possible. Key Requirements: - The system must update the following fields: - Product name - Product description - Meta Tag Description - Meta Tag Keywords (same as Product Tags) - SEO Heading Title - Meta Tag Description (160 characters limit) - I need the product description to be: - Minimum 200 words - Taken from the supplier's website - Translated from English to Danish - SEO optimization for each product Ideal Skills: - Proficient in Opencart - Familiar with APIs for data extraction - Strong in SEO and content writing - Able to work pro...
...Managing Support contacts This content is closed to future replies and is no longer being maintained or updated. Links may no longer function. If you have a similar request, please write a new post. Question 1 Replies 215 Views EmiliaA8 Member since 2019 3 posts Accenture SPA Posted: Feb 16, 2023 Last activity: Feb 16, 2023 CLOSED Integration with Social media Report Hello, for a request of our client, we need to integrate Pega with Facebook, Twitter, Instagram, Trustpilot, Apple Store, Google play, Google my business. The need is recover all the interactions made by these apps: messages, reviews, posts and show them on Pega. We have seen that Pega provides Digital Messaging : does this component allow you to both view and reply to a comment or ...
...El pago será de 0.015€/correo electrónico encontrado. Research/Data Collection: Email Search for Technology Companies - I am looking for a freelancer who can assist me in gathering email addresses from a list of companies. - The purpose of this project is to collect data for research purposes. - The ideal freelancer should have experience in data collection and be proficient in conducting online research. - The project requires gathering a substantial number of email addresses from a sample of 4800 companies aprox. - Attention to detail and accuracy are crucial in this project to ensure the validity of the collected email addresses. - The freelancer should be able to efficiently navigate var...
As a .NET developer with expertise in multi-tenant functionality, I am in need of a professional who can help me implement and refine this feature within my web application. It involves user authentication, tenant administration, and data isolation. Key Requirements: - Implement a robust user authentication system, ensuring that only authorized users have access to the system. - Develop a seamless tenant administration system, allowing me to manage different tenants within the application. - Ensure data isolation is maintained between tenants, guaranteeing that each tenant's data is secure and isolated from others. - Integrate DNS functionality within the application, allowing me to manage DNS, configure DNS records and r...
We have a list of around 4,795 energy consultants. This list contains the name of the consultant, the company name they work for, contact information including general email address, telephone number, website, and address. However, we need you to find out the personal corporate email address of each consultant, and insert it into Column K in the Excel sheet. Check the attached file. Time : 48 Hours Budget 50$ Lowest Bidder will win Milestone Payment : no advance milestone payment. After Completed work get payment. Thanks
(ALL INFO IN DESCRIPTION-SEND ACCURATE BID ELSE YOU WILL BE REPORTED)****** I'm looking for an experienced developer who can create a web-based calendar with a unique feature to allow my users admin to book dates. If a date is unavailable, the application should clearly indicate it. Calendar app **1. User Registration:** - Admin creates a new user by providing a username and password. - Store the user's credentials securely in a database, with password hashing and salting for security. -Allow user to make remember me so they don’t have to login each time. **2. User Login:** - User enters their username and password on the login page. - The system checks the provided credentials against the database records. - If the cr...
I'm seeking a freelancer to correct the date format in my Excel sheet that is currently not displaying correctly. Key Requirements: - The Excel sheet must display dates in the format DD/MM/YYYY. Additional Details: - The corrected date format is only required on specific sheets within the same workbook, not all sheets. Ideal Skills & Experience: - Proficiency in Excel and its date formatting functions - Experience with correcting date format issues in Excel - Attention to detail to ensure all specified sheets are updated correctly.
