Mdi form in vb.net example punët
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
See attachment. hfghjhgfghjhgfdsdgklkjhgfghjklknvbnmnbvcvbnm,.mnbvertyuytrertrghjugfdghjkjhgfdgkjhgfdfgjkjhg
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
laksjd laksj dlkasj dlkasj dlkasjdlkasjldkasdasda
I need a .NET software developer to work on a project for me urgently. Key Responsibilities: - Your main task will be software development. I need a professional who can create efficient and high-quality software for my project. Skills & Experience: - Proficiency in ASP.NET, Entity Framework, and Windows Forms is crucial. - Prior experience with similar projects or a portfolio demonstrating your capability in software development would be a bonus. The project is time-sensitive, so I need it completed ASAP. If you're a .NET expert who can hit the ground running on software development, I'd love to hear from you.
I am currently facing a fairly serious issue with my dot net software - it crashes habitually, specifically when performing a certain function or operation. This has proven to be a major nuisance and has hampered my tasks significantly. Key Objectives: - Discover the root cause of the crashes - Implement a robust and permanent solution to prevent future crashes This project calls for a seasoned dot net developer who has extensive experience with troubleshooting and issue-resolution. Having a strong background in software maintenance and optimization is a definite plus. The ideal candidate will possess: - Experience fixing crash issues with dot net software - Ability to work methodically to identify the source of the issue - Exceptional problem-solving capa...
I need a professional to convert my 1-page Word document into a .dotx file. This form needs to be minimalistic and easy to fill out. Key Requirements: - Convert an already laid out Word document into a .dotx file. - Include content control fields for a date picker, checkboxes, and empty text fields. - Design the form in a minimalistic and professional manner. Ideal Skills and Experience: - Proficient in Microsoft Word and creating fillable forms. - Knowledge of .dotx file format. - Experience with content control functions in Word. - Ability to design simple and professional forms. - Attention to detail to ensure the form is user-friendly. Please provide examples of similar work in your proposal.
I’m looking for an individual with a strong intermediate knowledge level of .NET to conduct training for a small group of 1 to 10 people. Here are the key details about the training to be conducted: - This role requires someone experienced with .NET Core and ASP.NET. Your primary focus will be these areas and you should be able to deliver training effectively on this. - As a trainer, you would need to have an excellent command of these concepts and the ability to explain them in a way that's easy for the participants to understand. - Previous experience with delivering .NET training is a significant plus. 1 day physially training for MIS level audience. location at Bandar Sri Damansara.
I'm in need of a skilled freelancer to create a fillable form in PDF format that can be both printed and filled out manually, as well as filled out on a computer. The form should be designed with user-friendliness in mind, making it easy to navigate and complete. While I'm not looking for any special features at this time, the freelancer should be open to implementing any necessary changes or updates to the form in the future. Ideal skills and experience for this job include: - Proficiency in creating PDF forms - User interface design - Familiarity with fillable forms and best practices - Ability to work according to specifications and requirements
necesito una app ya sea en VB code o inventor que lea en tiempo real 3 sensores calor corporal, ritmo cardiaco y estres, se necesita lo mas rapido posible.
necesito una app ya sea en VB code o inventor que lea en tiempo real 3 sensores calor corporal, ritmo cardiaco y estres, se necesita lo mas rapido posible.
I need a skilled C# developer to create a web form that can consume data from a RESTful API. The data must be in JSON format. Key Requirements: - Create a RESTful API consuming web form in C# - API response must be handled in JSON format - Implement User Authentication functionalities Ideal skills for this project include: - Proficiency in C# and web forms - Experience with RESTful API consumption - Understanding of JSON data handling - Experience with User Authentication systems Your primary task will be designing the web form for API consumption, ensuring it accurately handles data in JSON format and includes secure User Authentication. A strong background in C# development and RESTful APIs is crucial for success in...
...can work with Visual Basic and/or .NET to create an application with the following requirements: Backend Functionality: - User Authentication: Develop a secure and efficient user authentication system. - Database Integration: Implement a database management system to store and retrieve data. - API Integration: Integrate external APIs to enhance the application’s functionality. Frontend Development: - Develop an intuitive and user-friendly interface for the application. - Ensure that the frontend interacts seamlessly with the backend. Deployment: - Once the development work is complete, you will be responsible for uploading the application to the server of our choice. Ideal Skills and Experience: - Proficiency in Visual Basic and/or .NET - Experience in...
I'm looking for a UI designer to create a user experience that's specifically tailored for high net worth individuals. The project involves designing for both mobile (iOS, Android) and web platforms. Key Project Points: **Enhancing User Experience:** The primary goal of this project is to make navigation and interaction as intuitive and user-friendly as possible for such HNIs. **Multi-Platform Design:** The user interface should be consistent and optimized for both mobile (iOS, Android) and web platforms. Experience in responsive design is a must. For the phase 1, below are the requirements: $$ The application caters to investors / high net worth individuals, who want to invest in startups. Below 3 screens are expected: 1. On the homepage, th...
I'm in need of a skilled .Net 8.0 expert to help me fix a Google OAuth issue. The issue lies in the fact that I cannot authenticate users through Google's OAuth system. The primary purpose of this application is user authentication. Ideal candidate for the task should have the following skills and experience: - Proficiency in .NET 8.0 - Extensive experience working with Google OAuth - Strong problem-solving skills - A focus on clean code and system performance - An understanding of user authentication systems. Candidate must have experience with ServiceStack. Please explain what service stack is in the application. Issue needs to be sorted in 48 hours.
I need a freelancer to create a Mailchimp subscribe form. The form should have select choices that add tags to the subscriber when they check these choices. Ideal Skills: - Proficiency in Mailchimp API - Experience with creating custom forms in Mailchimp
J'ai un travail en continu concernant notre projet précédent ' connect a database and form'
J'ai un travail en continu concernant notre projet précédent ' connect a database and form'
I will be developing and integrating the required form till Thursday and fully functional till Friday. But I will try my best to complete the work as soon as possible.
...website designer who can create a custom Adobe PDF document for my website. This document must be tailored to my requirements, which include the integration of interactive form fields, as well as a unique design layout. Key Project Requirements: - Custom Adobe PDF Creation: The main task involves creating a custom PDF document optimized for my needs. This includes integrating interactive form fields. - Form Field Types: The PDF will need to have text fields, checkboxes, radio buttons, and support for basic arithmetic functions like addition and multiplication. Ideal Skills and Experience: - Proficiency in Adobe Acrobat: An expert in using Adobe Acrobat to create interactive PDFs. - Graphic Design Experience: Ability to design a visually appealing lay...
Sistema de gestión odontológica que tiene módulos de Login y seguridad, gestión de roles y permisos, ingreso de pacientes, ingreso de doctores, ingreso de servicios radiográficos, pagos de los servicios, reportes y gestión de los servicios radiográficos, se debe realizar en Net 6 u 8, Angular, Postgresql
I need a professional IT specialist resume writer. This resume will need to highlight my expertise as a FrontEnd webdevelopment proficient in Angular and .net. Key points: - You will need to have experience in IT resume writing. - The resume should focus on my skills as a FrontEnd webdevelopment. - Proficiency in Angular and .net should be highlighted. - The resume should get more than 95 score on jobscan. Skills Required
I need a professional IT specialist resume writer. This resume will need to highlight my expertise as a Full Stack Developer proficient in Angular and .net. Key points: - You will need to have experience in IT resume writing. - The resume should focus on my skills as a Full Stack Developer. - Proficiency in Angular and .net should be highlighted. - The resume should get more than 95 score on jobscan.
I'm looking for a reliable data entry specialist to assist with a basic online form filling task. My data will be provided in typed documents. Ideal skills and experience for the job include: - Proficiency in data entry - Attention to detail - Understanding of online forms Please be prepared to handle a basic online form, which will include fields such as name, email, and other simple information. Looking forward to working with you!
We are the largest and fastest growing UK charity community delivering support through multiple services via our website. Our website and AI machine learning and GPT are handled by others. We need dev support for the core SQL system and 2 small SQL directories, plus running reports and system admin. We need full stack Microsoft .NET development experience, strong SQL knowledge and exposure to Azure Microsoft services. We require a range of services. We’ll begin with the ad hoc work to begin to build a working relationship and then build that up to the following on an ongoing basis. • Ad hoc tasks for minor tweaks and changes on an ongoing basis. • Larger pieces of work, such as creating a moving from a free to a free and premium versions, with upgrading our He...
I'm in need of a detail-oriented freelancer to handle online form filling tasks involving simple personal information forms from digital documents (PDF, Word, etc.). Ideal Skills and Experience: - Experience in data entry and form filling - High attention to detail - Familiarity with digital document formats - Ability to follow clear instructions - Time management skills to complete tasks efficiently
I'm in need of a detail-oriented freelancer to handle online form filling tasks involving simple personal information forms from digital documents (PDF, Word, etc.). Ideal Skills and Experience: - Experience in data entry and form filling - High attention to detail - Familiarity with digital document formats - Ability to follow clear instructions - Time management skills to complete tasks efficiently
I'm in need of a detail-oriented freelancer to handle online form filling tasks involving simple personal information forms from digital documents (PDF, Word, etc.). Ideal Skills and Experience: - Experience in data entry and form filling - High attention to detail - Familiarity with digital document formats - Ability to follow clear instructions - Time management skills to complete tasks efficiently
I'm in need of a Full-Stack Developer who is well-versed in ReactJS, NodeJS, CSS, and Python. The project will require both front-end and back-end development. In detailed, we're developing a web workflow application and I'm looking for an experienced developer for a task of about 2-3 weeks to create an interactive workflow with React front-end and Python backend (see the 3 attachments to this post with the main job description is in the file MTQ - Upwork - Interactive Front Panel - and the other attachments are supporting documents). SUMMARY: Tabbed ReactJS forms with a Python backend that can interact with each other. The front-end can have a few input fields and a few interactive subcomponents in the form of either tables or ima...
I'm in need of a skilled professional to convert my JPEG image into a blank, text-based printable form. The project's primary goal is to create a form that can be printed and filled out manually. Key Project Requirements: - Convert a JPEG image into a text-based form: The freelancer will need to convert the contents of the image into a format that can be typed on, printed, and filled out by hand. - Creation of a Printable Form: The form should be optimized for printing purposes, ensuring that it maintains a high quality when printed. Ideal Skills and Experience: - Proficiency in Data Entry: The freelancer should have a good understanding of data entry principles and be able to translate the contents of the image into a text-bas...
...developer to assist me with a project involving an abandon form solution that integrates with Zoho CRM. Key points: - The primary task is to integrate the abandon form solution with Zoho CRM - Specific requirements include abandoned form tracking, email notifications, and CRM record creation - Troubleshooting and fixing issues may be required - This project may also involve some work on CRM, including form to CRM integration and creating a fillable PDF form template from CRM data Ideal skills and experience: - Strong Zoho development experience, with a proven track record of successful CRM integrations - Proficient in developing abandon form solutions - Experience in working with form to CRM integration and creating filla...
...for a professional to delink the existing Contact us form from our Hubspot and replace it with a form that will directly send us the email. I also want them to delink a Case study download form from Hubspot and replace it with an option to download directly and email us the person's contact details. The key requirements for this project are: - Understanding of WordPress and form integration - Ability to add an email notification feature for form submissions - Ability for user to download a document (Case Study PDF) The Contact Us form should be able to collect: - Full Names of visitors - Their Email addresses - Company Name - Phone number - Specific inquiries or messages they have Freelancers with previous experience i...
I am in need of a developer who can help create functionality in my project where a checkbox selection In a "Contract of Payment" form will spawn a "Bank Draft Form". Here's what I need: - Create a checkbox that when selected, spawns the Bank Draft Form - I already have the forms designed for this purpose, your task will be to integrate them with the checkbox functionality. I want it to toggle the second form on and off when the checkbox is toggled. - Unfortunately, I do not have the code to accomplish this, so I'm leaning on your expertise to bring this to life. The ideal freelancer for this task should be proficient in Javascript, PHP or any language/library that can deliver this functionality. Kno...
I am in need of an expert who can effectively conduct contact form outreach for my digital marketing business. My primary goal is to generate B2B leads by sending messages via the contact forms on potential client's websites. You will be given a list of prospects with the direct website address to their contact form. You will also be given the script to use (copy/paste). The list will be approximately 10,000 entries. Ideally we would send 500 per day. Key Responsibilities: - Utilize contact forms to reach out to other businesses - Clearly convey our services to potential clients - Generate viable leads for the company Ideal Skills and Experience: - Excellent written communication - Experience in B2B outreach - Knowledge in Digital Marketing...
I'm looking for a skilled developer who can create a Wordpress-based ordering form for my website. Key Requirements: - The form should be modelled after the one found at :// - It should be simple, intuitive, and easy to use. The product list with updated prices is here: https://docs.google.com/spreadsheets/d/1LHqa7mILqpH0WiFnj5PsZa5qwpeIBgFhV2QZXYtocR0/edit#gid=0 Specifics: - The form doesn't need to support a payment method; users will submit their order and payment will be processed offline, over the phone. Timeframe: I need this project completed ASAP.
I'm in need of a talented Keycloak software developer with a solid grasp of .NET. The primary goal of this project will be to develop a custom user management and authorization system. Key Responsibilities: - Create a custom user management and authorization system using Keycloak - Implement role-based access control - Develop user registration and profile management features - Integrate the solution with our existing user database The ideal candidate for this project would have: - Proficiency in Keycloak - Extensive experience with .NET - A strong understanding of user management systems and implementing role-based access control - Previous experience integrating user databases List of views: - Login - Users - App roles - User groups Development for U...
...updates Preferred Skills: - Proficient in AI, specifically in speech recognition and natural language processing - Experience in developing software compatible with Windows and Mac - Strong understanding of calendar integration and email automation On-Prem Client: Quivr Agent * Installation * Install Quivr Agent on Windows or macOS * Configure Quivr Agent to connect to local database and file system * Local Database * Use Azure Storage or Microsoft SQL Server as local database * Store indexed data and search results in local database * File System * Use Windows File System or macOS File System * Index local files and folders * Search * Search local database and file system for relevant results * Display search results in...
... I'm currently in a bit of a tight spot. A Windows Server 2016 web application () was recently moved from a US provider to the by a non-professional freelancer. Unfortunately, after less than a week, the system has stopped working. I found out recently he has installed the application in Linux instead of Windows against my guidelines. In light of this, I am seeking a highly skilled professional to help me reinstall the system and rectify all the problems at hand. The job involves the following steps: 1) Change the OS from Linux to Windows Server 2016 or Higher (This may cause the data to be erased. In this case use the copy of the site and reinstall 2) Download Windows Server 2016 II, Office 2019, , .NET Framework 4.7 or
I have a small node.js application and I'm looking for a d...application and I'm looking for a developer to make a design update specifically on the contact form UI. Key Requirements: - Design Update: The main task is to enhance the user interface of the contact form. - Node.js Expertise: Proficiency in node.js is essential for this project. - UI/UX Skills: A good understanding of user interface principles and best practices is necessary. Ideal Skills and Experience: - Strong Node.js Development Experience: A proven track record in developing node.js applications is a must. - UI/UX Design Proficiency: Ability to improve the user interface of the contact form. - Attention to Detail: I'm looking for someone who pays attention to the small d...
...for an individual or a business with a strong network of high net worth individuals and/or family offices that would be willing to introduce me to and help me pitch to them an Accountancy Practice Roll-Up project I am running and requires funding. I am looking to raise £500,000 in equity in rounds 1 and 2, within 3-9 months time. The payment will be as a percentage of the funds raised successfully for the project through this person or company. It will have to be equity participation. Loans are not considered at this stage. - Strong Network: Leveraging your connections to high net worth individuals is crucial. I need to tap into your relationships to pitch my business concept. - Industry Experience: Having a background in raising funds for ...
...com 2) Single/Double Occupancy in Single Product Page 3) Registration form with a. **Capture Basic Information:** - Name - Email - Phone - Occupancy type (Single or Double) b. **Capture Detailed Guest Information:** - Guest Names - Date of Birth - Nationality - Shooting Activity Participation (Yes/No) c. **Instructions Based on Occupancy:** - **Single Occupancy:** - Provide two rows in the form. - Indicate that the second row is for a non-shooting guest, who can be added for free. - Display message: "You can add a non-shooting guest for free to the accommodation." - **Double Occupancy:** - Provide two rows in the form, one for each participant. d. **Final Steps Upon Form Submi...
I have a Wordpress website which I want to add a custom php multistep form to. The multistep form is supposed to get some of it's data from my backend database and also should save the data entered on the form to the database. Ps:- Serious bidders and bid with finality. No side bids on chat please.
...directly to the customer site. There is also the role of the inside sales representative. More on this later. The software should be hosted by a web host. Our customers send orders electronically in EDIFACT format. These orders contain an order number, different delivery points, each of which has its own GLN (customer number), different items and the quantities of the items. There must be a way for the operator to independently create items that can be ordered. These items always have an EAN number, a product name and a net price. Net price is the price without VAT. The orders should appear in a list. When our employee calls up this list, he can see these complete orders and then decide whether he wants to process individual orders or all of them togeth...
NO AUTO BIDS - ONLY ZENDESK PRO! 'm in search of an experienced developer skilled in Zendesk API integration for a project related to airline claim forms. I will provide you parts of the template and you will add the form, calculations, API integration and ticket creations. The website should be built in Laravel or secure platform. If you know about EC261 claims it makes it way easier to choose you. You will do the following: - Create a form which is predefined through parameters and questions. - Add airline and airport database and organize the data with live search preview. - Calculations based on airport distance and claim form. - Zendesk ticket creation along with correct ticket numer and relevant information. - Multilingual form...
...database developer. The central point of the project is database management. • The main responsibility of the developer will be to create a database, and a form page in HTML • and link the form to the database Experience in the field of database and Mysql is necessary. , the form must be elegant and well displayed on laptop and tablet screens. the objective is when entering a reference in the form all the data in the row of the database table will be displayed in the form. if the reference number does not appear in the database the web page generates a message. The successful candidates will illustrate these skills throughout their portfolio in relation to previous projects. If you are sel...
...high-performance APIs and programs using C#, .NET Core based on architecture frameworks and guidelines Prepare API Collection and Documentation Collaborate with external and internal teams to test and troubleshoot performance and functional issues Work towards DevOps model for continuous integration (CI) and continuous delivery/deployment (CD) pipelines Technical Skills: API developers should have comprehensive technical skills, including the following: Ability to work on protocols like HTTP, FTP and Web Sockets Ability to create APIs using REST pattern Knowledge of GraphQL and gRPC is an added advantage Knowledge of Web Services and understanding of service-oriented architecture (SOA) Proficiency with common API development frameworks/tools, including .NET Core 6+, MS ...
...a basic HTML form that I need to be updated to look modern and professional. The key changes include updating colors and fonts, improving layout and spacing, adding modern styling and animations, and the inclusion of an image and background. Key requirements: - Update colors and fonts to create a modern, visually appealing form - Improve layout and spacing to make the form more user-friendly - Implement modern styling and animations to enhance the overall design - Integrate an image and background to improve the visual appeal further - The form should collect a single field of information, specifically the 'New Target' The form only has about 5 or 6 fields that are passed to it. The form is opened through a Python Flask app. Idea...
...retirement, investment growth, etc. The emphasis for name is on ‘trust', 'professionalism’ , 'Investment', 'Safety', 'Growth', 'Money', 'Protection', 'Long lasting growth' bringing to mind an image of dependability and expertise in wealth management Domain name availability: ".com" Domain should be available Ideal Skills and Experience of branding person: - Expertise in marketing and branding - Familiar with wealth management industry - Background in finance or related fields Responsibilities: - Create a brand name for Mobile Application that appeals to high net worth individuals - It must be original and memorable - The name should be short and should be easy t...
