Use web api in vb net punët

...extend my team and improve the quality of my service / output.l which in term would also allow me to start to take on a more overarching creative role and take on more clients. I’m not sure this is even the right place for this post but I’m basically trying to find someone who can in effect join my team creating websites on an ongoing, freelance basis. To be entirely honest I’m not sure how best to approach this. I anticipate most of the sites would be pretty straightforward and am thinking that perhaps a monthly retainer would work best but perhaps if the cost per site was right we could work on that basis? I am also able to do some ground work in terms of layout and design, as in I could literally mock up sites in illustrator a...

api intigrate karani hain plese contect me 9837194609

Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc

Desenvolvedor .NET MVC, SQL e ADVPL Protheus

See attachment. hfghjhgfghjhgfdsdgklkjhgfghjklknvbnmnbvcvbnm,.mnbvertyuytrertrghjugfdghjkjhgfdgkjhgfdfgjkjhg

asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr

Anti injection

ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif

... The ideal candidate will possess proficiency in middleware development or previous experience integrating disparate systems, preferably in a lab setting. Here are the specific tasks: - Develop an API or similar interface for System A to communicate with our lab management software. - Ensure that the retrieved test results are accurately pulled from System A. - Format the retrieved data into JSON before it's saved into our management software. A strong understanding of JSON is necessary, as this is the format that the retrieved test results must be saved in. Knowledge of laboratory automation systems, in particular, will be highly advantageous. This task requires attention to detail and an understanding of the sensitivities involved in...

I'm in need of an experienced SQL Server data warehouse designer to help with a project of integrating and consolidating data from different sources. Key requirements: - Expertise in SQL Server: You should be able to design, implement and optimize data warehouse solutions on SQL Server. Understanding data warehouse design principles is essential. - Data Integration: You'll need to work with some of our developers / power users to source data and establish automated integration; experience with integrating relational databases and APIs from web services is crucial. - Data Consolidation: You should be able to create a cohesive, consolidated dataset from these different sources applying appropriate design principles. - Medium-sized project: The data needing in...

...plugin. Transfer the existing production woocommerce to this staging server. 3) ongoing long term development of our CRM app Other components of our stack which are a HUGE ADDED BENEFIT if you can work on them -> .NET ASP, WEB API + MS SQL DETAILS HERE -> PRIORITY IS TO HAVE A DEVELOPER ON OUR TEAM (LONG TERM) THAT CAN FOR NOW ALSO WORK WEEKENDS AS WE HAVE SEVERAL EMERGENCIES TO FINISH URGENTLY. Someone who can efficiently manage Linux VPS and efficiently use GITLAB is critical. Initially we need part of the hours to be worked in the first weeks from 8:00PM- 2:00am UTC -3 (Brazil Time) later you can work on your time zone. Prerequisites: For the long term project the *STARTING* wage will be as stated below. 1) Accept initial hourly...

Hindi Ai Voice Call needed for our customers in India. Vapi Platform alongside integration of Dialog Management API, DND API, User Authentication API and other API integration needs to be done. Please look at the file attached.

I'm in need of a skilled CodeIgniter developer to assist in fixing and potentially creating APIs. The project is expected to last around 3 hours. Key Responsibilities: - Evaluate and address issues with existing APIs in CodeIgniter - Develop new APIs as necessary Ideal Candidate: - Proven experience working with CodeIgniter - Skilled in API development and troubleshooting - Proficient in identifying and solving technical issues - Strong communication and collaboration skills Please note that the specific APIs to be worked on and the systems they will be integrating with are yet to be defined. Your expertise in both API development and CodeIgniter will be crucial. My Budget - 1000 INR , I will share list of API in...

...WORK WEEKENDS AS WE HAVE SEVERAL EMERGENCIES TO FINISH URGENTLY. We will start with 5-10 small task in and then go to some smaller .NET tasks all with 1 day sprints for you to become familiar with the software and then our main goal will be to integrate another B2B API for our MVNO. Initially we need part of the hours to be worked in the first weeks from 8:00PM- 2:00am UTC -3 (Brazil Time) later you can work on your time zone. If you are awarded the task we expect you to accept IMMEDIATELY and if the project is not accepted immediatly we will award it to another developer. To qualify you must be full stack and work PROFICIENTLY with gitlab and code in ., .NET ASP, WEB API + MS SQL. We also have woocommerce and have developed...

I'm in search of a skilled Backend Node.js developer, proficient with , to manage two key aspects of a project. Key Responsibilities: - **Database Design and Implementation**: Your primary task will be to design and implement a database system. I prefer PostgreSQL, so experience with this DBMS is a must. - **API Development and Integration**: The project requires a complex API development and integration task. You should be comfortable dealing with multiple endpoints and third-party integrations. Ideal Candidate: - Proficient in Backend Node.js development with a focus on - Prior experience in designing and implementing PostgreSQL databases - Proven expertise in developing complex APIs with multiple endpoints and third-party integrations...

...Additionally, I'm looking for a talented Software Developer proficient in Python, Java, JavaScript, and C#, who has experience in chatbot development, both Front-End and Back-End Development, and API Integration. Ideal Skills: - Proficiency in Python, Java, JavaScript, and C# - Experience in Front-End and Back-End Development - Familiarity with Dialogflow and Microsoft Bot Framework - Strong knowledge in AI, Machine Learning, and NLP - Previous experience in chatbot development Roles and Responsibilities: - Develop and train machine learning models for chatbot functionalities - Integrate AI components into the chatbot for automated decision-making - Implement NLP techniques to enhance chatbot interactions - Proficient ...

I require a skilled website developer who can build an informational website for me, ensuring it is user-friendly and satisfies the following criteria: - It should feature engaging use case content that is easy to navigate by visitors. - The website's interaction should be based mainly on allowing users to efficiently search for information. Previous experience in creating similar informational websites would be beneficial to achieving the best results. Knowledge in effective SEO practices is also highly desirable.

I need an experienced developer to fix current issues with my ansible code. Facing two primary challenges: 1....current issues with my ansible code. Facing two primary challenges: 1. Connectivity issues: My ansible code fails to establish a steady connection during its runtime. 2. CMDB Retrieval Issue: There's a problem retrieving data from the Configuration Management Database (CMDB). The data is being accessed directly from the CMDB rather than through any API. Ideal Skills - In-depth understanding of ansible code - Experience with CMDB - Knowledge in data retrieval procedures Please note there are no specific authentication or permissions involved. All the data access is being done using direct file access. Your task would be to streamline this process and...

...experienced web developer to design and build a site that will facilitate the buying and selling of gold and silver for registered users. Your main tasks will include: - Integrating the features of user registration and the functionalities of buying and selling. - Implementing the Supplier API, indeed one of the fundamental features. - Embedding methods for users to make payments either via credit/debit cards or bank transfers. The real gold and silver will be represented by tokens allowing for fractional purchases and sales. Knowledge of blockchain technology will be very helpful as transactions will be recorded on a blockchain. Skills that would be beneficial for this project include proficiency with API integration, an understanding of secure payment proce...

I'm in need of a skilled photographer who is adept at enhancing and editing pictures. The pictures I need to be edited are meant for personal use, and they are a of a father and son. Key Requirements: - Color Correction - Retouching - Background Removal - The pictures should be edited in a natural and realistic style. I'm looking to work with a professional who can make these pictures even more special. Ideal Skills and Experience: - Proven experience in picture editing, especially for personal use - Ability to deliver clean, natural and realistic editing - Attention to detail - Strong communication skills, as we may need to discuss the editing direction. Please provide examples of your previous work, especially if you've edited fami...

I'm in the process of launching a new enterprise, a website dedicated solely to football video highlights. The aim of this platform is to attract viewers and generate ad revenue. Requirements: - **Video Highlights:** I prefer to source the video highlights from an existing API, such as the one from This provides a vast selection of football action to draw in viewers. - **User Interface & Experience:** The website should be intuitively designed and easy to navigate. Users should be able to easily locate, access, and view their desired highlights. - **Revenue Generation:** The website should be optimized for ad placements. The goal is to maximize revenue from viewership through strategic ad positioning and formats. - **Scalability:** As a new enterprise, the s...

I'm in need of a Big Commerce developer to work on my website. I am looking for the following: - Customizable templates: I need to be able to make minor tweaks to existing templates. - Custom API integrations: Specifically, I need to integrate Payment and CRM APIs. The ideal candidate for this project will have experience in Big Commerce development and customization, as well as expertise in integrating API's, particularly Payment and CRM services. A good understanding of e-commerce best practices is also essential. Kindly provide examples of similar projects you've worked on. Long term project but low price. If you agree it, please bid!!!

Preciso de uma pessoa que faça a instalação e configuração de uma instância do Izing (Preferência pelo PRO com SaaS) ou Whaticket em uma VPS. O profissional deve possuir a expertise necessária para assegurar que não exista nenhu...Whaticket em uma VPS. O profissional deve possuir a expertise necessária para assegurar que não exista nenhum backdoor ou script malicioso no pacote usado para instalação. O pacote de instalação é de responsabilidade do profissional. Preciso das seguintes funcionalidades: • Suporte a API Wpp não oficial; • Chat multiusuário; • Transcrição de áudio • Configuração de chatbot com di...

...when it comes to implementing the Twitter API into my project. I am in need of step-by-step guidance on how to properly set up the process. Key Points: - My main issue lies in the actual implementation of the API into my project I'm looking for a freelancer who can help me navigate through the Twitter Developer Account process. This includes: - Detailed guidance on the process of setting up the Twitter Developer Account - Step-by-step instructions on implementing the Twitter API into a project You should have: - Proficiency in Twitter Developer Account setup - Strong understanding of Twitter API best practices - Excellent communication skills to walk me through the process step-by-step Please note, the ideal candidate should have...

...app stand out in the market. Key Features: - User Registration and Login: Secure and efficient onboarding process. - Advanced Search Functionality: A powerful and intuitive search that helps users find what they're looking for quickly. - Messaging and Communication Features: Seamless communication between users, ensuring a positive and engaging experience. Design: - A modern and minimalist design that appeals to our target audience. - A professional and corporate look that also reflects our brand identity. Integration: - Social Media: Seamless integration with popular social media platforms to facilitate user sharing and engagement. - Payment Gateway: Integration with trusted payment gateways for secure and convenient transactions. - Google Maps: Utilizing Google Maps ...

I'm looking for a skilled freelancer to develop a customized net worth spreadsheet. This spreadsheet should enable me to meticulously track my financial progress across various categories. Key Requirements: - The spreadsheet should allow me to input and monitor: - Investments (especially individual stocks) - Debt - Savings - Income - Expenses - Other category for miscellaneous expenses or income - I require a simple, user-friendly design that makes manual data entry easy and intuitive. Skills and Experience: - Proficiency in spreadsheet software such as Excel or Google Sheets is essential. - Experience in financial tracking and net worth management is highly beneficial. - Understanding of stock market, investment tracking, and basic accoun...

...Creating dependencies between tasks: It should be possible to create task dependencies. - Showing progress of tasks: The tool needs to visualize the progress of tasks in a clear and intuitive way. - Generating reports: The tool should be able to generate reports based on the data input. Customization: - I'm looking for a tool with advanced customization options. This includes the ability to add custom fields, create templates, and tailor the tool to the specific needs of my team and projects. - Custom API to for tasks to add through API Ideal skills and experience: - Proficient in front-end and back-end development - Experience in creating project management tools - Familiarity with drag and drop functionality - Prior experience with kanban boar...

I'm looking for a detailed guide on how to get tweets using the RTweet library in R. Key points include: - Explaining the setup process of the Twitter Developer Account since I'm facing issues with access - A detailed, step-by-step guide on how to leverage the RTweet library for tweet lookup and analysis - Troubleshooting guidance for known issues Ideal skills: - Proficient in R programming language - Strong understanding of the RTweet library - Experience with Twitter Developer account setup - Ability to explain complex concepts in a simple manner - Troubleshooting experience with the Twitter API

Interactive web browser app (mobile compatible) that does a simple questionnaire, based on 0. Home page where user is prompted to START. UI should be clean and feel open and creative. Shouldn't be much on the home page. Should be an area/page to show some instructions of the app. 1. Before the questionnaire there are some options to choose, e.g. language, version of Bible, sections of the Bible i.e. Pentateuch / History Books / Writings / Prophets / Old Testament / New Testament. The user doesn't have to choose these each time, just the first time, to be saved in browser. If they want to modify it in the subsequent questionnaires they take, they are able to do so as an option. 2. Then there is a simple 10 question questionnaire. All using API logic...

...looking for a skilled developer who can create a custom API for Instagram. Key Requirements: - **Data Access**: I aim to gather all public data from Instagram users, including their feed, stories, highlights, and posts. - **Authentication**: I'd like to authenticate users using an API key for accessing their data. Ideal Skills and Experience: - Proficient in API development and integration. - Familiar with Instagram's API policies and practices. - Knowledge on how to work with user data, such as profiles, media content, stories, and highlights. - Prior experience in similar projects would be a great advantage. Will using on site like this The goal of this project is to access and organize Instagram data in a specific way,...

I'm in need of a skilled professional who's proficient in working with the Turvo TMS Rest API for a project that involves its integration. The main goal of this project is to leverage the capabilities of the Turvo TMS Rest API to streamline and enhance our shipping processes. Key responsibilities of this role will include: - Working on the setup and authentication of the API - Handling data retrieval and manipulation - Implementing effective error handling and debugging mechanisms If you've got proven experience with the Turvo TMS Rest API and are confident in your ability to help us automate our shipping processes effectively, I'd love to hear from you.

I'm looking for a skilled WooCommerce developer with expertise in PHP and shipping API integration to help me implement a shipment tracking feature for my online store. Ideal skills and experience would include: - Strong proficiency in PHP and WooCommerce - Extensive experience in integrating shipment tracking APIs - Familiarity with Royal Mail / ParcelForce shipping services - Good understanding of customer satisfaction strategies in an e-commerce setting Key responsibilities include: - Integrating the shipment tracking feature into my WooCommerce site - Ensuring the feature is seamless, user-friendly, and integrates well with the existing site - Making sure that the tracking feature is reliable and accurately reflects the status of the shipments...

I'm in need of an experienced web app developer to create a Food Finder application. This app aims to help users discover nearby food spots and make informed decisions based on peer reviews. Key Features: - Location-Based Search: The app should enable users to search for food options based on their current location or a specified area. The system should provide accurate results and filter distant options. - User Reviews and Ratings: Users should be able to rate and review the restaurants they've visited. The overall rating and individual reviews should be openly accessible to other users. Compatibility: The app should be optimized for web browsers to ensure universal access. Ideal Skills: - Proficient in web app development - Experience i...

I'm looking...looking for a Python developer to help me set up a VONAGE API to send SMS messages. Key Project Details: - The main functionality I need is to set up the ability to send SMS messages. - The application should be efficient, reliable, and easy to use. - I'm not yet sure if I need two-way communication or if the application will need to support sending messages to multiple countries. Skills and Experience: - Strong experience working with VONAGE API is a must. - Proficiency in Python, with a focus on SMS messaging. - Ability to create a reliable and user-friendly application. - Familiarity with creating two-way communication systems and international messaging support would be an advantage. If you're a Python developer with VONAGE ...

I just need one task to be done I'm in need of a PHP Developer for a new project. The parameters and required skills are fairly open, as I've not declared any specific frameworks or preferences. Ideal candidates include those who possess: - Broad knowledge of PHP across various frameworks. Although Laravel, CodeIgniter, and WordPress were the options given, these indications were not selected, thus creating an open space for any skilled PHP professional to apply. - Experience in both website and web application development. There's an opportunity to work on several PHP development projects, potentially ranging from website building, application creation, to API integrations. - An impressive design eye. I've left the space open for any desig...

In search of a skilled WordPress expert to integrate social app logins into my existing website. This includes creating the necessary Facebook, Google, and Twitter apps, and then integrating the keys into WordPress to enable social login functionality. What I'm Looking For: Expertise in WordPress development and feature integration Ability to create Facebook, Google, and Twitter apps Integration of app keys into WordPress for social login activation. You will need to create the developer account and API for Google, Facebook and Twitter.

Looking for a Full Stack Developer >6 years of experience in agile development of scalable SaaS apps in the cybersecurity area: Improve our app (URL Risk assessment) Improve our app (Domain Typosquatting) Improve our project (Darknet Monitoring) Create an app "hackerview" for passive attack surfave enumeration Create an app for detecting spoofed social media profiles Create an app to scrape ransomware threat actor website and maitain stats about those sites Improve an existing app to monitor paste sites Mininmal Tech Experience: MERN, REST API (JWT), Django, Python, Github, CI/CD, Celery, Redis, Linux, Postgress, Kubernetes, Docker, Nginx, JS, HTML5, Protocols (DNS, SMTP, SSL, HTTP..).Detailed app specifications will be shared at a later stage. |----...

We're in need of an experienced professional who can complete my WooCommerce and WordPress sites with a focus on design customization, product page setup, and payment gateway integration. We have a specific set of tactics that I need implemented on both sites, all of which have been pre-defined. The ideal candidate should have: - A strong background in customizing WooCommerce and WordPress development - Experience with design customization - Proven expertise in API for manufacturer - Able to meet for daily sprints during United States business hours, Central Standard Time zone. Please only apply if you have a portfolio demonstrating your successful completion of similar projects. PROJECT - $500 We will not respond to offers higher than the project...

I require a seasoned API developer to create a new API specifically for my Android application. The API should not only facilitate user authentication but also share relevant product information. Key Functions: - User Authentication: Implement functions to register new users, log in existing users and reset forgotten passwords. - Product Information: Provide product data access including descriptions, prices, and availabilities. Ideal Skills and Experience: - Experience creating APIs for Android applications. - Proficiency in user authentication processes. - Familiarity with handling product data through APIs. - Understanding of secure coding practices. By prioritizing data and user security, the API should also be designed to scale and acco...

...pushing the boundaries of the platform. Here's what we need: Shopify Expertise: In-depth understanding of Shopify's file structure, directories, and templating system (Liquid). Experience manipulating orders, grabbing data from the database, and crafting custom views using Liquid shortcodes. Proven ability to develop custom Shopify plugins to achieve complex functionalities. Technical Skills: Proficiency in Shopify development languages (Liquid, JavaScript, HTML, CSS). Experience with database manipulation (likely MySQL). Communication & Collaboration: Excellent written and verbal communication skills in English. Ability to clearly explain technical concepts to non-technical stakeholders. Comfortable participating in regular video calls to ...

...nodeJS program that will retrieve an xls file from an email inbox in order to geocode the addresses present in the file via the Google Maps API and insert the geographic coordinates into an SQL table. You can follow these steps: 1. Retrieve the xls file from the mailbox - cron every hour 2. Normalize the xls file for integration into a MySQL table 3. Configure access to SQL database from JavaScript. 4. Insert data into table via SQL query 5. Retrieve addresses to be geocoded from the SQL table. 6. Use Google Maps API to geocode each address. 7. Insert the geographical coordinates (latitude and longitude) in the SQL table. Each line in the xls file corresponds to a delivery. The file has 15 columns. The column names are, in ord...

I'm searching for a skilled JavaScript developer who also has solid experience using Chrome Developer Tools for debugging. The main responsibility of this project will be to analyse and understand functionality of a web application and website. To succeed in this project, you need to: - Be an expert in JavaScript. - Have advanced proficiency in Chrome Developer Tools. - Have a solid understanding and previous experience with web platforms. - API integration experience.

Estou em busca de um desenvolvedor Python experiente para um projeto que envolve a integração do WhatsApp com o ChatGPT da OpenAI. O objetivo é criar um bot que permita comunicações fluidas e traduções em tempo real entre inglês e português, utilizando as APIs do Twilio e OpenAI. Responsabilidades: Integrar a API do WhatsApp via Twilio com a API do ChatGPT. Implementar funcionalidades de tradução e correção de texto em tempo real. Requisitos: Experiência prévia com as APIs do Twilio e OpenAI será considerada uma vantagem. Capacidade de escrever código limpo e bem documentado. Excelente habilidade de resolver problemas e de comunicação.

...assist with integrating an Inventory API to my WooCommerce plugin. Key Requirements: - Integration of Inventory API: You will be responsible for linking the chosen Inventory API with my WooCommerce platform. This will involve ensuring compatibility and seamless data transfer. - Synchronization: The inventory information should be synchronized both automatically and manually based on my preferences. This includes real-time stock updates and other essential product information. - Usability: The integration should be user-friendly, allowing for easy manual synchronization through a button click. Ideal Skills and Experience: - Proficiency in WooCommerce: You should have a strong background in WooCommerce development, including experience with API ...

...involves some advanced functions like Windows API calls and file manipulations, and I need it to be converted to C# code. The C# application doesn't need to have a GUI, it only needs to replicate the functionality of the Autohotkey script. API used - GetMenuItemCount EnableMenuItem GetMenuString Ahk method used MouseGetPos CoordMode WinExist WinGetClass LButton::return SendMessage WinGetTitle WinGet WinActivate ControlGetFocus Key requirements: - Convert an advanced Autohotkey script that customizes application behavior to C# code - Ensure the C# code replicates the original Autohotkey script's functionality - No GUI is required in the C# application Ideal skills and experience for this job: - Proficient in both Autohotkey and C# - Experience ...

...immediate need for a skilled React Native developer to handle extensive API integration on both iOS and Android platforms. Your tasks will mainly revolve around integrating the app with required APIs. Key Responsibilities: - Integrate the app with the necessary APIs to ensure its smooth functioning. - Ensure cross-platform compatibility, taking into account the specific requirements of iOS and Android. Ideal Skills: - Proficiency in React Native and its ecosystem. - Strong understanding and experience in API integration. - Experience with developing for both iOS and Android. - Ability to work under tight deadlines. Your speed and efficiency in completing this task are crucial. Immediate availability and previous experience in similar project...

...will have experience in speech processing, real-time communication systems, and cloud services. Responsibilities: - Design and develop a high-performance backend system for real-time audio processing and translation. - Integrate speech recognition and translation APIs from leading providers. - Implement a scalable real-time communication architecture to support voice calls. - Ensure data privacy and security compliance in voice transmission and storage. - Work closely with UX/UI designers to create a seamless and intuitive user interface. - Test and optimize the system for various devices and network conditions. Requirements: - Proven experience in real-time communication software development. - Strong background in audio processing, preferably ...

...functionality and features of and The project has a set deadline. Critical requirements include: - Expertise in PHP development - Experience in building a SaaS platforms - Google My Business API on the server to fetch review data. - API on the server to fetch review data from other platform like Trustpilot, Facebook, Yelp and Amazon review - Ability to replicate similar functionality and features from a reference website Main functionalities required: - Platform formation from scratch - Comprehensive platform construction - User Registration and Login - Product Rating and Review - API Integration We aim to replicate similar features and functionality from the reference site, making this a critical aspect of the project. Previous experience

Gostaria de contratar um Redator para escrever artigos de tecnologia e negócios para um blog corporativo. Quero um redator experiente em artigos de Tecnologia que escreva considerando SEO, Iremos propor os temas (abaixo), porém gostaríamos de receber sugestões de ...meio e fundo de funil. Nosso foco sera em torno de temas como Transformação Digital, Integração B2B, Inteligência Artificial, novas tecnologias e novos modelos de negócios. Inicialmente gostaríamos de publicar 1 artigo por semana, podendo aumentar a frequência de publicações. Temas: - Inteligência Artificial - FinOps - Integração empresa-empresa via tecnologia - API (Produtização e Mo...

Hello, I have my Python/Django site hosted on PythonAnywhere and it's facing a NET::ERR_CERT_DATE_INVALID issue. Website : I would appreciate someone help to troubleshoot this issue and fix the NET::ERR_CERT_DATE_INVALID error, ensuring that the SSL/TLS certificate is correctly set up. - Website troubleshooting and error resolution - SSL/TLS certificate configuration. Thanks in advance !