Vb net parallel console app punët
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
I'm seeking a skilled developer to enhance my online gaming streaming platform. Key Goals: - Increase Viewership: The platform should be designed to attract more viewers. - Enhance User Experience: ...platform should be designed to attract more viewers. - Enhance User Experience: User interaction should be intuitive and engaging. - Monetize Through Ads: It should support effective ad placements. Key Requirements: - Platform Availability: The platform must be compatible with gaming consoles. - Game Focus: Our focus will be on streaming first-person shooters. Ideal Skills: - Proficiency in web and console development. - Thorough understanding of streaming platforms. - Experience in enhancing user experience and viewer engagement. - Ability to effectively integrate and optimize...
MUST READ FIRST =============== MUST HAVE - Blazor experience of at least 3 years - Latest version of .NET & SQL Server - At least 1 hour of availability between 6:00PM and 11:00PM EST - Your price is the one that you REALLY want to have with 10% +- NOTE - APIs will be provided (you will not develop APIs) - No development will be done on My Computer. - DO NOT APPLY if your fees can exceed 10% or your bid PROJECT I have C# Blazor Web App that works using SQL Server Database & using APIs at the same time. For the functions that use the database, I want to replace them with the APIs 1- Make code debuggable. 2- Error message appear with no details, need to make the error message has Show More to display the details of the error. 3- Load Codes from APIs instead of...
...should be white in color - Design changes should be made, but no specific design has been decided upon yet. I'm open to suggestions from the freelancer. - The replacement shell should possess a level of enhanced durability that suits moderate use. This is key to ensure the longevity of the product. Ideal skills and experience for the job: - Prior experience in designing and creating custom gaming console shells - A keen eye for Details (shell needs to fit perfectly onto existing faceplate) and the ability to create visually appealing, custom design - Experience with the PS5 and/or other gaming consoles is a plus I'm looking for a freelancer who can deliver a high-quality, custom-designed replacement shell that meets the criteria mentioned above. After the initial ...
I'm in need of an experienced Google Play Console owner to help me with my mobile gaming app. Ideal Skills and Experience: - Extensive experience in publishing and managing mobile gaming apps on the Google Play Console. - Good understanding of the app store guidelines and requirements. - Ability to optimize app store listings for increased visibility and downloads. - Strong communication skills to discuss and negotiate offers. - Ability to provide guidance on improving the app. Looking forward to seeing the interested console developers. Please share your console link so we can discuss the offer further. Thank you.
I have a mobile application that needs to be deployed specifically on Android 11 using the Google Play Console. Key Requirements: - Deployment: The mobile application needs to be successfully deployed on the Google Play Console. - Android 11 Compatibility: Ensure that the application is fully compatible with Android 11. Ideal Skills and Experience: - Experience with Google Play Console: The selected freelancer should have prior experience in deploying applications on the Google Play Console. - Android Development: A strong background in Android app development is crucial to ensure the application is compatible with Android 11. Please provide your relevant past experience with similar projects when bidding.
...someone experienced in installing SSL certificates on Azure hosting. We run two .NET based sites on a single Azure instance - they are: We have control of the domain, but need to work with our client for control of the subdomain. We will purchase a multi-domain Comodo SSL certificate from NameCheap (potentially a new PositiveSSL Multi-Domain certificate again) and have you activate it and install it on the Azure service. The current SSL is due to expire on the 28th May 2024. Key Requirements: - Install the SSL certificate on an Azure instance hosting my two .NET sites. - Ensure that both sites are configured to run with HTTPS. The ideal
I'm looking for a developer experienced in .NET Core and Umbraco to make modifications to an existing Umbraco project. The main focus will be on changing the CSS and the Free Trial form, which needs to be integrated with a CRM system. Key Requirements: - Proficiency in .NET Core and Umbraco - Skilled in CSS customization - Experience with CRM integrations - Understanding of user authentication in Umbraco The main tasks include: - CSS changes to improve the overall look and feel of the site - Customizing the Free Trial form, particularly: • Layout and design adjustments • Integration with a CRM system for effective lead management Your expertise in Umbraco components, particularly in navigation menus, contact forms, and image carousels, will be beneficial...
I'm seeking a skilled SEO specialist to help our site reach local customers. Key Tasks: - Conduct keyword research to identify high-value search terms relevant to our local audience. - Implement on-page optimization techniques to ensure our site is search engine friendly. - Facilitate the building of quality links to our site fr...brand new; we haven't initiated any SEO activities yet. Ideal Skills and Experience: - Proven experience in local SEO, especially in the context of brand new sites. - Strong proficiency in keyword research and on-page optimization. - Demonstrated ability in link building, particularly in generating local and relevant backlinks. - Familiarity with tools like Google Analytics and Google Search Console. - Excellent communication skills and a proa...
...around Exotic and Collector Cars. I need a comprehensive market research and Total Addressable Market (TAM/SAM/SOM) analysis specifically focusing on the exotic automotive lending industry. Key Points: - Industry Focus: Exotic Automotive Lending - Information Required: - Market size and growth potential - Competitor analysis - Customer demographics and preferences Target Audience: - High net worth individuals - Car enthusiasts - Exotic car dealerships Ideal Freelancer: - Proven experience in market research and TAM analysis - Specific experience within the automotive or lending industry would be a plus - Ability to synthesize data and provide actionable insights - Understanding of the dynamics and trends in the exotic automotive market - Strong analytical skills and the...
I am seeking a skilled .NET developer to create a Windows application with the following features: - User Authentication and Authorization: The application should ensure secure user access and have roles-based permissions. - Database Integration and Management: Experience with handling complex data and ensuring its security is essential. - API Integration: The application needs to communicate with external systems through APIs. My primary concern is scalability. The application must be designed to grow and handle an increasing number of users without compromising performance. Hence, I am looking for a developer who can plan and implement a scalable architecture from the very beginning. The ideal candidate should have: - Proficiency in .NET framework, particularly for Windo...
I'm looking for an SEO expert to significantly increase the organic traffic to my websites. The...industry, is highly desirable. - Proficient in conducting keyword research and analysis. - Proven track record of increasing organic traffic and improving search engine rankings. - Familiarity with SEO tools like SEMrush, Moz, or Ahrefs. - Strong analytical skills to monitor and report on the performance of SEO strategies. Target Audience: - Businesses interested in offshore financial solutions - High net worth individuals seeking wealth management services - Individuals looking for offshore banking and company formation If you have a solid background in SEO, particularly within the financial services sector, and can help boost the visibility and sales of my websites, I'd lo...
...experienced developer to upgrade my ComicBase Mobile app, currently running on Xamarin, to .Net Maui. The app is utilized on both iOS and Android platforms. Key tasks include: • Deliver full conversion from Xamarin to the latest .Net Maui framework • Replace the current ZXing barcode library • Determine and implement a suitable alternative barcode library like , or others that meet my project specifications (refer to the attached requirements) - Add lesser fixes and update requirements (see attached) • Ensure compatibility across both iOS and Android platforms The ideal candidate should have: • Extensive experience in Xamarin and .Net Maui • Deep understanding of barcode libraries • Proven track rec...
I'm seeking a skilled database developer to help me successfully migrate my database from .NET Framework 4.8 + EF6 + AspNet Identity to .NET 6 + EF Core + Identity. The database size is small - less than 1 GB, but it's crucial that user data is meticulously preserved during this transition. Key Tasks: - Perform data migration without any data loss. - Ensure the user login system and roles functions seamlessly in the new system. Ideal candidate should have: - Proven experience in .NET Core and EF Core migrations. - Strong attention to detail, particularly regarding user data. - Proficiency with user login systems in a .NET environment. Attached is the project source.
Hello I need an experienced programmer willing to take a project that requires attention to detail and precise understanding of the subject matter. I can give extensive details about the ideal functioning of the spreadsheet I need done, however, this is an overwview: Track all gross/net profits track all account balances track all bank balances track all ongoing and completed bets on each account track across futile types of bet single and sequenced (this will require custom logic) as well as more basic things. im looking of a single place for everything to happen and for the right person to create it. No work will need to be done with external API this is only an internal management and accounting system.
Se debe mantener un sistema hecho en .Net el cual esta vinculado a una base de datos SQL Server de Microsoft. El postulante debe manejar a la perfeccion el idioma Español.
I'm seeking a skilled .Net developer to assist in developing a comprehensive retail system that has features such as user authentication and authorization, inventory and product management. Requirements: - Proficiency in C#, .Net, Entity Framework and SQL Server - Ability to develop a retail project from scratch - Strong understanding of user authentication and authorization - Experience in inventory management and product cataloging It's crucial that the chosen freelancer has prior experience in building online retail systems and a strong understanding of the retail business model. The ideal candidate should be able to deliver a secure, efficient and scalable retail project. Any experience with Angular/react/Node would be plus
I require a developer with expertise in integrating payment gateways into WordPress websites. The project involves adding ICICI's complete suite of payment options including Net Banking, Credit Card processing, Debit Card processing and UPI to my two website. This integration is critical for the collection of membership fees on my website. Required Skills and Experience: - Solid experience with WordPress Web Development - Strong knowledge of ICICI Payment Gateway - Experience with integrating multiple payment options - Expertise in ensuring safe and secure payment transactions. I am currently using PayU and want to change it
I have a xenserver with four windows virtual machines. it is installed in a DELL server with RAID. A electricity failure damage the boot and got the grub rescue console. I load ubuntu from a usb and can see the lvm partition, but can copy. So I need some one to help me to copy the virtual disk to other xenserver instalation to load the fout virtual machines.
I'm in need of a professional who is experienced with Microsoft Azure and can assist me in deploying a .net framework webform application as an azure web app
...images and videos recruiters can search CVs with a Boolean type search functionality & save searches. Candidates and recruiters can message each other. Admin can manage the back end. Suggested technical skill set but not a complete one… • Cloud-based server solution • Azure or Single server solution • MS SQL Database (NoSQL document database might be more appropriate?) • OAuth • Payment gateway • .net We suggest design led development process where we sign off the look and feel of the web pages… the back end is for the supplier to advise the best scalable solution for the application. Please send your credentials/ skill sets and cost structure for said application. We require excellent communication in English via regular onl...
I'm seeking a seasoned .Net developer with a touch for excellence, required for maintaining existing .NET projects. Key Responsibilities: - Maintenance, upgrades, and problem-solving of existing .Net-based projects. Expected Skills: - Proficiency in web, desktop application development and database management. - Experience maintaining .Net projects. - Fast learner, able to grasp the specifics of diverse projects. Note: Knowledge of any specific .Net version wasn't specified; demonstrate your versatility. Regards, Dipak
...updating on Google Console. This issue is affecting all sections of our website. We're specifically seeking help from freelancers who understand this kind of issue and have the appropriate skills to sort it out quickly. Your task will include: - Analyzing the cause of the issue within Google Console and our website's backend - Implementing a solution to ensure SEO tags update as expected - Doing a thorough testing to confirm everything is working perfectly again I will provide access to the website's backend or content management system for easier troubleshooting and resolution. Ideal candidate for this job: - Proficient in website backend and SEO configurations - Experienced in solving SEO tags update issues - Excellent problem-solving skills - Pr...
We already have a login flow for our own hotspot solution developed in PHP. We now need to modify the login flow to incorporate SMS login. This is a minor project involving copying and pasting the flow from one versio...login flow to incorporate SMS login. This is a minor project involving copying and pasting the flow from one version to another. The SMS integration is already completed. We require someone who can implement these changes to the login flow without altering the entire setup. Additionally, we need to integrate the option to upload marketing material, currently done manually, into the existing admin console. Skills and Experience: - Expertise in PHP - Proficiency in UI/UX design - Prior experience in implementing security features - Proven track record of improving sy...
...proficiency in C# and C++, especially in relation to the .NET Framework 4.0. The project's primary aim is to craft a game launcher that offers multi-platform support, but it is crucial to emphasize that our focus for now is on Windows. In case of it's in C++, the following note are required: - The launcher is meant to launch a process (The game exe) also it meant to have a settings window, and support window that contains a "Subject" - "Email" - "How may we help?" and all those data to be sent in HTTP Get request. If it's C#, I only ask for the [Designed Form] as mentioned * Buttons needs to be smooth and high quality animated while mouse hover and mouse click. Key Qualities to have: - Proficiency in C# and C++ - Familiarity with ...
The following questions must be ANSWERED or your proposal will be IGNORED 2. Please send your top 3 best work examples (especially demonstration of any Saas systems or Online Ma...will be IGNORED 2. Please send your top 3 best work examples (especially demonstration of any Saas systems or Online Management Portals, Could base ERP systems) 3. Please send your proposal with your monthly salary expectation JOB DESCRIPTION We are an eCommerce company that requires an experienced Full Stack .Net / React Developer with strong API development experience to join their team due to a significant increase in product demand. Skills & Experience 3+ years C#.NET experience ASP.NET Core HTML5 CSS3, SASS, LESS, Bootstrap, Agile Development Experience Excellent written & ve...
I am looking for a senior software engineer with experience in Java, Python, and C#. The main task is to develop a robust web application using Spring Boot. Familiarity with Azure and .NET will be a plus. Key requirements include: - Developing a web application - Implementing User authentication - Integrating with databases - API integration Ideal candidates should have: - Proven experience in Java, Python, and C# - Strong knowledge of Spring Boot - Familiarity with Azure and .NET - Ability to implement User authentication - Experience in database and API integration. I'm looking for a professional who can deliver high-quality work in a timely manner.
I'm looking for an experienced .NET developer to assist with a project. This project requires someone who has a strong background in .NET technology, particularly in C# programming, ASP.NET development, and SQL database management. Ideal candidates should have experience in developing web applications, creating software solutions, and improving existing systems. The key functionalities to be implemented by the .NET developer in this project include user authentication, data encryption, and payment integration. If you're a .NET developer with a solid understanding of the above technologies and functionalities, please reach out to discuss the project further.
I'm in dire need of an expert in Google Play Store's developer console to assist with app distribution and app management. Key responsibilities include: - Managing app distribution process, ensuring smooth functioning and accessibility - Overseeing version updates and securing necessary permissions Please note there has been a slight snag. My app was removed from the store, which needs addressing. Although I'm uncertain of the exact reason for removal, your role will involve diving into this and clarifying the issue. Ideal Skills - In-depth knowledge and experience in Google Play Store development and operations - Skilled in managing app distribution and updates - Capable of strategizing and implementing plans to boost app ...
I need a professional who can scrape and compile email lists of high net worth individuals with a particular income level and investment interests. The emails will be used to target our automated trading software offer. Key Requirements: - Income Level Criteria: The emails should target individuals with an income level within the range of $250,000 - $500,000. - Investment Interests: The targeted individuals should have an interest in the stock market, Futures trading, options trading, cryptocurrency, and real estate. Ideal Skills and Experience: - Proficiency in data scraping and email list compilation. - Familiarity with targeting high net worth individuals and their investment interests. - Previous experience in compiling email lists for targeted marketing campaigns.
We're looking for a professional with experience in creating compelling video ads for diverse demographics, aiming to gener...presented attractively and informatively, demonstrating their value and potential return. Knowledge in the financial sector will be an advantage. - Audience: The videos will be targeted at Millennials, High-net-worth individuals, and Retirees. Understanding their motivations, pain points, and financial goals will be critical in the success of these ads. The ideal candidate should have: - Proven experience creating successful social media ad campaigns - Understanding of the financial sector and investment products - Ability to research and target audience insights (Millennials, High-net-worth individuals, Retirees) - Excellent storytelling and...
Hello! I need WordPress developer who can fix Core Web Vitals issues in Google Search Console and make my all URLS in good. I see most issues are related to INP, and LCP. It consists of searching for “heavy” database queries and rewriting them into “lighter” ones. This also includes optimization of the code itself. You also need to get rid of unnecessary plugins, and some need to be rewritten. Since it is plugins that are often the “brakes” in the operation of the site. My site is WooCommerce and experiencing issues related to lower speed as well. I want you to implement proper caching, image optimization, script optimization, reduce unnecessary plugins etc. I don't want you to use plugins but need manual work. Also We had some issue with...
I'm looking for an expert in Technical SEO to help me increase my website traffic. My primary goal is to drive more organic visitors to my site. At the moment, my website's SEO isn't optimized at all, so I need someone who can work from the ground up and make the necessary adjustments. The ideal candidate should be proficient in the following areas: - Technical SEO: I ne...structure and make the necessary changes to ensure that it's SEO-friendly. - SEO Best Practices: Beyond just fixing issues, I'm looking for someone who can implement best practices to ensure that my website is primed for high search engine rankings. - Analytical Skills: I also need help with tracking the progress of the SEO changes, so experience in using tools like Google Analytics and Google S...
For this project, I'm seeking a versatile freelancer with a background in both physics and game development to assist with my PC and console game. It will be a simulation game where physics play a crucial role. Your responsibilities will include: - Designing the physics model for the ball - Helping with implementation if needed - trajectory calculations for the ball. The ideal freelancer for this job will have an understanding of physics to ensure the simulations are accurate and can be realistically integrated into a game environment. Experience with game design and programming for both PC and console platforms is also key.
I'm looking for a full stack developer with expertise in rolling out B2B white-labeled solutions. Key Requirements: - Strong Experience with .Net, React, React Native, MongoDB, and AWS - Experience in developing white-labeled solutions - Understanding of User authentication and User management - Ability to provide features like Branch Management and Databases - Previous experience with small scale projects (10-50 users) Your role would be to help me create and implement a system that allows businesses to use my product under their brand. This would include setting up user authentication, managing user details, enabling branch management, and ensuring the system can scale up to 50 users without a hitch. Experience in developing similar solutions and strong knowledge in the sp...
...and purchasing these drafts. - **Post-Purchase Delivery**: After a customer purchases a legal draft, I would like them to receive an email link to download the document. This will necessitate a system that can automatically generate and send out these emails upon successful transactions. - **Payment Integration**: The website should support multiple payment methods, including credit/debit cards, net banking, and digital wallets. This will cater to a wider audience and provide convenience for customers. The ideal freelancer for this project should have experience in e-commerce website development, particularly in creating systems for selling and delivering digital products. Familiarity with incorporating and testing payment gateways is a plus. Effective communication skills are...
I'm seeking a .NET Core developer well-versed in fo-dicom or a similar open-source library to create a web-based DICOM viewer. The viewer should be developed using .NET Core web 8.0 with Razor. Key features include: - Image viewing and manipulation: The viewer should allow users to view DICOM images . - Patient information display: It must display relevant patient information in a clear, concise manner. - Measurements and annotations: Users should be able to make measurements and annotations on the images. - Play series: The viewer should support playing a series of DICOM images. The player should be capable to run on Mac, windows and linux i.e. platform independent and should not require any installations on computer. It should run from any external disk like pen driv...
Hi, I have my website that is an old domain. I used to be in the top five on local search before the COVID. Now I have almost no search traffic No alert from google in the search consol I have quiet some content on the website. The website is fast. Some time ago bad SEO guy did some bad links that I removed throught the search console Somebody has been doing some linking since 8 month and I'm still very low. I'm looking for someone who can tell me what could be fixed, or if I need to change domain name... Thanks
App and Web for same industry institutions(All in one) 1. Users to access all institutions' info on the same and one app 2. Institution to pay fees to be visible on the app par category Platinum Diamond Gold Silver Bronze 3. Every week reclassification based on extra payment 4. Clicking on tab , the app will show all institutions' info. Redirection to the institution app 5. Users should also vote using Net Promoters Score(NPS) method 6. The NPS will be sent to all institutions every month 7. The user would win points and MoMo money if he/she recommends the app to other users Condition : recommended users should download/Install/verify/visit at least one institution app/web and recommend new users 8. The instituti...
I aim to consolidate my online presence by linking a Google Site to two existing domains. The domains are currently live and host content (I am aware that this will 'disappear'). Despite not being well-versed in web hierarchies and structures, I am open to suggestions. I have changed the DNS (Text) records to verify ownership - one domain seems verified, as it brings me to google console and the website is still not verified/linked. the other domain stays unverified too. I even tried Forwarding on one domain, but no luck. Ideal professionals for this project would: - Have extensive experience with Google Sites and domain linking - Be able to work with existing domain content - Possess strong communication skills to explain potential structure or hierarchy changes.
Get ready for a Zoom meeting I'm looking for a SEO expert who can help me optimize over 250 pages on my website to increase traffic.
need seo experts/developer to fix google search console/SQL index issue. we have many pages not indexed on gsc, need seo experts/developer to fix it. I'm currently facing an issue with pages on my website not being indexed and therefore not showing in Google's SEO results. It's crucial for the successful completion of this project to have these pages visible on Google again. Ideal candidates for this task should have: * Extensive experience with Google Search Console * Proven expertise in resolving indexing issues * A deep understanding of SEO best practices Please include your past work related to resolving such issues in your application. A detailed project proposal would certainly be a plus. Prompt completion is advantageous, although a precise timel...
I'm looking to add UPI features to my desktop application created with C# .Net. This will involve replicating the encryption and decryption used in major UPI apps, as well as integrating with multiple UPI payment providers and banks. The main features I'm aiming to incorporate are: - Check balance: The application should be able to retrieve and display the user's account balance. - Register: Provide a seamless registration process for new users. - Check pending UPI requests: Show the user any pending requests that require their action. - Approve payment requests: Allow users to approve UPI payment requests. - List of bank added: Display a list of banks that have been added to the user's account. - Data store/retrieve should be in json. -use httpclient ...
vb 2012 video and sound recorder. Auto record to file when motion/sound is detected. Auto save file if no motion/sound is detected for 5 seconds. exe File must be compact and small and not dependent on other dll or ocx. Auto detect existing cam and video device on PC. I should be able to compile it on my PC. Note there are a lot of samples on Chat GTP.
I'm in need of a professional software engineer who can craft a sophisticated travel organizer for us. The project will consist of both a ...It's crucial for the software to include a robust trip planning feature that enables users to schedule and organize their travel plans efficiently. - Expense Management: Implementing a reliable and user-friendly expense management system is an essential aspect of the project. The ideal candidate should have a strong background in software engineering, particularly in Angular for the frontend and .net for the backend. Previous experience in developing similar projects, especially in the travel industry, will be a huge advantage. It's also important for the freelancer to have good problem-solving skills, as well as the ability to...
I am looking for a skilled Android developer to create a ffmpeg demo app that is prove the concept of few advance command that is worked on windows console - ffmpeg Android - ffmpeg -rtsp_transport tcp The ideal candidate should have experience in ffmpeg Android library and expert only
...-Monitor and analyze website performance metrics, including traffic, rankings, and conversions, to measure the effectiveness of SEO campaigns and identify areas for improvement. -Proven ability to manage multiple SEO projects simultaneously, prioritize tasks, and meet tight deadlines in a fast-paced environment. -Proficiency in SEO tools and software, such as Google Analytics, Google Search Console, SEMrush, and Ahrefs, to analyze data, track performance, and inform strategic decisions. Ideally, you will have 3-5 years of experience in SEO, with proven success in the technology sectors, particularly with Local businesses, to improve the rank of keywords in Google SERP. You should be able to demonstrate a strong understanding of search engine algorithms and the latest industry ...