Vb net source code billing punët
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
...accounting software with essential features that will allow me to manage my finances, track inventory, generate GST reports, and handle billing. This software should also support up to 5 users. Key Features Needed: - Financial Management: The software should offer robust financial management functionalities to help me track and manage my finances effectively. - Inventory Management: A sophisticated inventory management system is required which involves product categorization, stock monitoring, and purchase order tracking. - GST Reporting: The software should have the capability to generate accurate GST reports in compliance with the relevant regulations. - Billing Features: I would require the software to support invoicing, payment tracking, and automatic payment reminder...
...my users' dashboard to the latest Angular version. The primary focus of this project is to optimize the dashboard's performance through responsive design. Key requirements: - Need to complete user dashboard UI from .NET API to the latest Angular version - Implement a responsive design to enhance load speed and overall performance - Prioritize optimizing charts and data visualization for a better user experience This project will require strong expertise in Angular, particularly in developing responsive designs. The ideal candidate should also have experience working with .NET APIs and be able to effectively optimize data visualization for improved performance. If you have a solid background in these areas and can deliver a high-quality, responsive user dashbo...
I'm seeking a technically proficient freelancer to facilitate an integration between my website's payment gateway, Stripe, and Vendus, the Portuguese billing software I currently use. Ideally, the integration should have the following features: - Automatic invoice generation in Vendus in response to transactions completed in Stripe, eradicating the need for manual data input. - Allow secure and efficient transaction process. The ideal candidate for this project will have strong experience with both Stripe and Vendus software, and a proven track record in similar integrations. Understanding of Portuguese is a plus but not essential. Please include examples of similar work when bidding.
...understanding of current SEO best practices - Ability to use Visual Studio Code for collaboration and development The successful candidate will be able to deliver a high-quality, compelling, and SEO-friendly article within the specified word count. The use of ChatGPT to generate engaging content will be a crucial aspect of the project. You must also be able to incorporate LSI keywords effectively to improve the SEO value of the article. We're looking for an experienced ChatGPT professional proficient in Python and familiar with LSI (Latent Semantic Indexing) keyword extraction techniques to create a top-ranking, SEO-optimized article for our website. The ideal candidate should have experience utilizing Visual Studio Code as the development environment and be skille...
...system to process live streaming video feeds - Find volume of a dirt pile using multiple fixed cameras and any other needed sensors in .NET core C#. Examples of apps already built - URC Ventures Stockpile Reports Lite iPhone app; ; Use openly available camera appliances so we shall be independent of any specialty vendors. Please provide testing procedures and testing tools in simulated conditions. If some 3rd party tools are used, our pre-approval, source codes and unlimited licenses be included, meeting our requirements given here. We shall get complete IP, documented source code and supporting docs and user manuals etc. like for the examples. We shall expect a professional solution with reasonable expectations of
I'm seeking a skilled C# .net developer to improve the performance of my application. - Scope: The project involves fine-tuning the existing codebase, optimizing database queries, and enhancing the overall performance of the application. - Skills: The ideal candidate should have a profound understanding of C# .net development, experience in performance optimization, and a strong grasp of database management. If you're proficient in identifying bottlenecks and implementing solutions to boost system speed and efficiency, I'd like to hear from you. Please share your past relevant experience.
I require an expert Flutter developer to create a tailor-made billing app for my business. The main functionalities encompass invoicing, expense tracking, and inventory management. Key Requirements: - Development of an app using Flutter. - Design an easy-to-use interface for invoicing. - Develop expense tracking tools to monitor business costs. - Implement inventory management functions to help control stock levels. Ideal Skills and Experience: - Proficient in Flutter development. - Previous experience designing and developing billing apps. - Familiar with developing invoicing, expense tracking and inventory management features. - Portfolio showcasing previous applications developed.
I need an experienced HVAC technician to install a Mr Cool air source heat pump in my backyard workshop. The ideal freelancer for this job should have: - Prior experience with installing air source heat pumps - Attention to detail, ensuring safe and effective installation - Ability to provide guidance on optimal usage and maintenance Your proposal should include an overview of your experience with similar projects, as well as an estimated timeframe for installation. Familiarity with local building codes related to HVAC installations will be appreciated. Mrcool DIY 12K BTU 4th Gen Energy Star Ductless Mini-Split Air Conditioner
...2-week review of our existing C# and PHP code. This project involves reviewing the existing code and it's performance, efficiency, and quality. Ultimately, we need a detailed documentation on the code's state and recommendations on the necessary steps for completion. (See attached file) Key Tasks: - Review and assess existing C# and PHP code for performance, efficiency, and quality. - Identify completion steps. - Create detailed document outlining current state and necessary completion steps. - Recommend testing Ideal Skills and Experience: - Proficiency in C# and PHP. - Experience developing SQL database applications (MySQL is preferred) - Extensive experience in software development and code assessment. - Strong understanding of ...
I'm looking for a proficient ASP .NET MVC developer who can help me create a web application with a specific focus on music streaming. Key functionalities of the project include: * Building the web application from scratch with ASP .NET MVC * Synthesizing a user registration system. It's essential to track user activity for future features, but no user login will be required to access content. * Establishing a data analytics feature. This data should be accessible to admins and will be used to gauge user preferences and activity. * Incorporating real-time notifications. This functionality should alert users of new content, primarily new music uploads. An essential part of this project is the local storage and streaming of music files. These files need to be store...
******************************************************************* Send me a message proving to me that you have read the project. ******************************************************************* If you are familiar with AWS programming, this should be a ...-started Requirements: • I will create a new AWS free account and will supply credentials. • In my AWS account, configure any IAM role/policy/user/credentials needed to run the example program. • Change the example program to accept credentials (accessKey/secretKey) as arguments passed to the executable. • Ensure that the corrected code successfully converts the speech in the audio file to text using the AWS Transcribe service. Deliverables: • All source code • Instructions on ex...
I'm looking to add a static QR code to a Facebook post. This QR code should link to a social media profile, which will be provided. Key Requirements Include: - Placement: The QR code should be placed in a Facebook post. - Content: The QR code should contain the data for a specific social media profile. Ideal Freelancer: - Proficient in Facebook post management - Experienced in QR code generation - Knowledgeable in social media profile linking - Attention to detail and precision Please propose your approach to this task and any relevant experience you have with QR code integration on social media platforms.
I'm in need of a skilled .Net developer with a strong background in C# programming. The project at hand involves the creation of a web application, specifically a content management system (CMS). Key requirements: - Proficiency in C# programming is essential - Strong grasp of the .Net framework - Experience in developing web applications using ASP.Net MVC - Prior experience with CMS development is highly preferred Your primary responsibility will be to develop a robust, efficient, and user-friendly CMS. This involves creating a system that allows for easy management and modification of digital content. If you have a proven track record in C# development, particularly within the context of web applications and CMS, then I'd be very interested in hearing from yo...
I have a backend code for a pre-existing fully function website and mobile app. The backend code is currently all written in php. I need someone to convert this existing php code into fully functional python code which I can deploy.
I'm seeking an experienced WordPress developer to craft an e-commerce website primarily using Easy Digital Downloads. Here's what I'm looking for: - Create an intuitive and seamless e-commerce experience. - Integrate Easy Digital Downloads as the core marketplace plugin. - Set up multiple Indian payment gateways, such as Net Banking, BHIM, GPay, and Phone Pay, ensuring security and ease of use. - Optimize site for performance, scalability, and SEO. Ideal Skills: - Proficiency in WordPress & Easy Digital Downloads - Experience with payment gateway integration - Strong portfolio with e-commerce examples - SEO and performance optimization expertise The successful freelancer will demonstrate a strong understanding of e-commerce strategies, particularly within the W...
...and do version control RESPONSIBILITIES: - Integration of new B2B APIs - New payment gateway integration - - Implementation of bug fixes and performance improvements. - Regular software updates and security patches. - Feature additions and enhancements. Skills and Experience: - Proven experience in maintaining e-commerce solutions. - Ability to work independently and meet deadlines. - .NET and are a plus but not a requirement. Prerequisites: For the long term project the *STARTING* wage will be as stated below. 1) Accept initial hourly rate of U$5.00 2) If awarded, accept and start work IMMEDIATELY 3) Have MINIMUM OF 20+ hours a week for long term ongoing support and development. 4) Work hours: predominantly 20:00 to 02:00 (UTC -3 Brazil TIME) 5) Be available to work on wee...
I'm looking for a skilled iOS developer to create a billing app using SwiftUI and Combine. The Android app's development build will be provided, which includes a screen showing a list of the APIs with details like requests, headers, etc. There are multiple modules in the app, such as Accounts, Customers, Stock, etc. We can set milestones based on these modules. The project is already set up, and some functionalities are already working, including the API layer. The code is very clean and easy for any developer to understand. Further details will be given on a call. We need a productive developer who creates pixel-perfect code. Experience does not matter; you must test the features you create.
Convert 2 page brochure from PDF to AI files. Recreate source files from PDF for easy editing. Create a layer from each section. Copy the text from each section. i.e. each image is a layer, each text block is a layer, each text heading is a layer For reference-page1 should contain approximately 19 layers.
We are looking for a computer program that can take over some of the repetitive tasks we currently do manually. The program will primarily be used on Windows OS and should be capable of performing the following functions: - Automating data entry tasks - Organizing files efficiently - Managing emails effectively - Checking invoices to prevent double billing Ideal candidates for this project should have: - Experience in developing Windows-based automation software - A strong understanding of data entry, file organization, email management, and invoice checking processes - Proficiency in designing user-friendly interfaces - Ability to integrate error prevention mechanisms to ensure accuracy Your solution should help us streamline our work processes, reduce human error, and increase ...
We are l...pages • Interest in conducting research and learning new things to overcome challenges • Conducting website performance tests • Monitoring the performance of the live website • Experience optimizing web pages and improving page speed • Collaborate with internal teams to produce software design and architecture • Write clean, scalable code using NET programming languages • Test and deploy applications and systems • Revise, update, refactor and debug code • Improve existing software • Serve as an expert on applications and provide technical support • Designing and managing the website back-end including database and server integration • Generating WordPress themes and plugins Payment will ...
Experienced Salesperson for Medical Billing and Coding Course Webinars Are you a skilled salesperson with a knack for engaging audiences and driving conversions through webinars? We are looking for a dynamic and experienced individual to join our team and help us sell our 100% job-guaranteed Medical Billing and Coding course. About Us: We offer a comprehensive Medical Billing and Coding course designed to provide students with the skills and knowledge needed to secure a job in the healthcare industry. Our course is backed by a 100% job guarantee, making it a highly attractive option for prospective students. Position: Experienced Salesperson for Webinars Responsibilities: Conduct engaging and informative webinars to promote our Medical Billing and Coding cour...
...Klocwork for C/C++ programming. The report should cover the following: - **Installation and Setup**: A detailed guide on how to install and set up Parasoft and Klocwork for C/C++. - **Configuring Rules and Standards**: Explanation on how to effectively configure rules and adhere to coding standards within both software. - **Analyzing and Obtaining Results**: An insightful overview on how to analyze code and obtain results using Parasoft and Klocwork. - **Pros and Cons**: Pros and cons of using both tools and an unbiased comparison. Ideal candidate should have: - Profound experience with Parasoft or Klocwork - Strong knowledge of C/C++ - Exceptional technical writing skills The report must be well-organized, engaging, and suitable for a reader unfamiliar with the tools. It shou...
Dynamic Website for www.fastlinktz.com. Fastlink Tanzania deals with IT Solutions like webhosting, email service, domain registration, software and hardware. Also Fastlink Tanzania has a sister company called Bless Solutions Company which deals with general trade. ref 1. main page: 2. Web hosting/email services: ht...www.fastlinktz.com. Fastlink Tanzania deals with IT Solutions like webhosting, email service, domain registration, software and hardware. Also Fastlink Tanzania has a sister company called Bless Solutions Company which deals with general trade. ref 1. main page: 2. Web hosting/email services: 3. Bless solutions:
I'm in need of a capable and experienced developer to create new C++ code from scratch for an Action/Adventure game. Requirements: - Develop comprehensive C++ code that satisfies the requirements and concept of an action/adventure game - Ensuring a highly interactive and engaging user interface - Maintain high performance and prevent any bugs or errors Ideal skills and experience: - Experienced in coding from scratch using C++ - Strong background and portfolio in game development, specifically in action/adventure games - Ability to troubleshoot and problem solve potential issues quickly and efficiently The end product should be a well-structured and written code that can be easily built upon in the future if needed. Candidates should be detail-oriented and a...
...of changes to my existing web application. The application is built on .NET, C#, MVC and MSSQL. The main areas of focus are: - **Database modification(If need)**: - **Adding New Features(If Need)**: I'm looking to integrate some new features into the web application as per requirement. - **Front-End Modifications**: I need some enhancements on the front-end, focusing on design/UI changes as per requirement. Additionally, the project would also involve: - **Back-End Modifications**: These would be required to ensure the new features are implemented effectively. - **Bug Fixes**: Any existing issues within the application should be identified and rectified. The ideal candidate should have extensive experience in .NET, C#, MVC and MSSQL. Additionally, they should ha...
...introduce DTLS to an existing system for secure communication. - Tight deadline: This project needs to be completed within two weeks. Timeliness and reliability are crucial. I need the data coming from the server to the client over UDP socket to be encrypted with DTLS, and it should appear as DTLS in the protocol section of Wireshark. In addition, the code should be able to handle streaming video or live feed over the socket accordingly. This code should work in linux and windows. Ideal Skills and Experience: - Proficiency in C: Extensive experience with C language is a must. - DTLS Knowledge: Prior experience implementing DTLS is highly preferred. - Security Background: Strong understanding of encryption protocols and data integrity is necessary. - Time Management: Abi...
I'm in need of a skilled and experienced Amibroker coder to help me write AFL code that will be used to automate trading activities in the Stocks and Futures markets. Key Responsibilities: - Writing AFL code to implement a strategy that will automatically execute trades based on predefined rules. - Ensuring the code is robust, efficient and able to handle the complexities of both the Stocks and Futures markets. Ideal Skills and Experience: - Extensive experience in writing AFL code for Amibroker. - Proven track record in developing and implementing automated trading strategies. - In-depth understanding of both the Stocks and Futures markets to ensure the code is appropriate for both. If you're interested, please provide examples of previous A...
If you are familiar with AWS programming, this should be a simple task for you. I have included an example C# solution using AWS Transcribe that I need to be working. Example Program: AWS ...-started Requirements: • I will create a new AWS free account and will supply credentials. • In my AWS account, configure any IAM role/policy/user/credentials needed to run the example program. • Change the example program to accept credentials (accessKey/secretKey) as arguments passed to the executable. • Ensure that the corrected code successfully converts the speech in the audio file to text using the AWS Transcribe service. Deliverables: • All source code • Instructions on executing executable with actual credentials
I am having trouble with authentication issues in the .NET framework. Specifically, the login functionality is not executing as expected. Details: - The issue is particularly with the login failures. - The problem is not that users can't login despite their credentials being correct, but rather the login functionality not executing as expected. Ideal Skills and Experience: - A deep understanding of .NET Framework - Proven track record in resolving .NET authentication issues - Experience in troubleshooting and debugging login failures - Strong knowledge in .NET authentication processes.
I’m seeking a skilled developer to convert my existing PortVB Desktop App into an iOS/Mac Desktop App. It a small tool that runs on a Windows PC and reads some flat XML files and inserts/updates a mySQL database. We need the same program to be able run on a iOS/Mac desktop. I have all the VB Project files/ Source code. - Skills in app development for iOS/Mac, ideally with previous experience in app conversion - Knowledge of data syncing, user authentication, and offline access, in case these features need to be incorporated - Familiarity with contacts management, communication, scheduling, calendar integration, and file/document management functionalities for potential focus areas - Creative design skills to potentially revamp the user interface and overa...
Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.
SEI Membership Club, the leading international company, is home to exceptional high-net-worth individuals who are self-made, often billionaires, entrepreneurs, nobility, high-level professionals, and elite members. The company needs talented artists who are abstract and landscape watercolor and oil paint experts
Job Title: Full-Stack Developer for WordPress, .NET Middleware, Azure Integration, and SDK Development Job Overview: We are seeking an experienced Full-Stack Developer to spearhead the development and integration of key system components within our e-commerce platform. The successful candidate will lead initiatives to enhance user interactions by developing a WordPress plugin, building a robust .NET middleware API, and integrating advanced Azure-based messaging services. Additionally, the role involves creating an SDK to facilitate easy integration for third-party AI bot services. This position is crucial for ensuring that our platform not only meets current technological standards but also adapts to future advancements and user needs, enhancing both the scalability and func...
I'm looking for an expert who can put together a precise and comprehensive multifamily proforma that focuses on cash flow details. Specifics Required: - Include data on net operating income, debt service, and cash on cash return. - An in-depth monthly breakdown of these values. Skills & Experience: - Proven track record in financial analysis, specifically real estate and multifamily property market. - Professional approach with strong attention to detail. - High-level proficiency in using proforma software or Excel. - Understanding of the specifics of rental property cash flows.
I am looking for an experienced Full Stack developer with experience in TypeScript to rewrite the existing codebase of a web application. We have a copy of the old code base and all the tech stack interactions but require the code to be rewritten as we no longer have rights to the current webapp. Ideal Skills: - Proficient with TypeScript - Hosting with Vercel and Neon - Code review and improvement - Strong knowledge of software development principles and best practices. Please mention your relevant experience when bidding for the project and provide a brief explanation of how you plan to approach this task. Details will be ironed out once the freelancer has been chosen.
I'm looking for a skilled individual to handle our company's billing clerical tasks. The main responsibilities for this position will include: - Invoicing & Payments: You will be responsible for generating and sending out invoices for us. This requires precision and attention to detail to ensure the accuracy of every invoice. - Account Reconciliation: Another key task will involve balancing and reconciling accounts. This will involve using both QuickBooks and FreshBooks software, so experience with these platforms is essential. - Customer Communication: You will also be communicating with our clients regarding billing and payment issues. Clear and effective communication skills are crucial for maintaining good relationships with our customers. On average, we g...
I am looking for an experienced CNC programmer to help me program M codes on my Syntec 60W-e CNC controller. I have 3 unused out relays that I want to use, and I would like each of them to be assigned to specific M code...looking for an experienced CNC programmer to help me program M codes on my Syntec 60W-e CNC controller. I have 3 unused out relays that I want to use, and I would like each of them to be assigned to specific M codes. Here’s what I need: - Assign M code e.g. M30, M50 and M80 to the unused output relays. - The function they should perform is to turn an external device on/off. Skills and Experience: - Previous experience with CNC programming is crucial. - Familiarity with Syntec 60W-e CNC controller will be highly advantageous. - Proficiency in M code ...
...assignment options, deadlines, and priority levels. Checkin/Checkout Page: View information about indivuals who are going to checkin and checkout. Stock Management Page: Manage stock on a given property. Reservation Management Page: Manage guest information, reservations, and communication. Contents: List of upcoming guests, reservation details, and communication tools. Billing and Invoicing Page Automate and manage billing and invoicing for property owners. Contents: Invoice creation, payment tracking, financial reports, and transaction history. Couple of small pages to be added, please consider this in your proposal. Responsibilities: Creativity and Innovation: You have the freedom to suggest improvements and make creative decisions that enhance user experience. Respo...
I currently need an experienced online industrial designer who can help me perfect a textile net for my product designed for basketball practice. The main task will be to take the prototype of my existing product and make improvements so that the textile net pushes the balls towards the center of the court. What I want is not a video or a photo, I want computer checks and force studies to verify and test the reliability and probability of what happens when a ball passes through the inside of the funnel with the subsequent purpose of sending it to be manufactured. It will be necessary to provide measurements, material and verifications.
I urgently need an expert in C# to integrate my Point of Sale/Enterprise Resource Planning (POS/ERP) system with QuickBooks Online. The goal is seamless synci...is seamless syncing of different modules, including, but not limited to: - Customer Information - Inventory Status - Purchase History - Sales Records - Products, Categories, etc... Familiarity with QuickBooks Online APIs and proficiency in C# .net Core is imperative for this role. Past experience with similar projects will be highly valued. The timeline is urgent; I need this integration done ASAP. we already have a code we made integration with SAP Business One, we can share this code to have the fastest development, and also we have the code of a previous developer who made of Quickbooks so it wou...
Description: We are seeking a talented web designer to enhance the design and user experience (UX) of our car audio dealers' e-commerce website. Our current platform h...Provide design deliverables using Figma or similar tools. Requirements: - Proven experience in web design and UX for e-commerce sites. - Proficiency with Figma or equivalent design software. - Ability to work within platform limitations to deliver a high-quality design. - Strong portfolio showcasing previous design projects. Additional Information: - You will collaborate closely with me (a .NET and React TS developer) to ensure seamless implementation of the design. - Clear and effective communication is crucial for this project. If you have a passion for web design and a keen eye for detail, we'd lo...
I have a dataset of images and I'm looking for someone experienced in U-Net algorithm. Project description: - Write PyTorch U-Net training model on top of provided base code (, , , ). - Train the model until achieving a validation dice score of min. 0.875. - Deliver source code and trained model until Wednesday 10 pm (Vietnam time zone).
We are urgently looking for a skilled data researcher who will research online UK based local planning authority databases for certain information sets. - Specific focus is needed on planning submissions and permissions that require BNG (biodiversity net gain credits)(the leads). The information is to be taken from Local Planning Authority official websites (publicly available information and no logins required). An in-depth knowledge of planning submissions and permissions and BNG is NOT needed. What is however required is accurate information to be taken from those websites and converted into a database for us. - This work can be done remotely and only requires a computer and access to the internet. - The geographical focus of the UK planning authorities we require information ...
I'm looking to buy a complete and *READY* code for a football management browser game (like Hattrick, Trophy Manager, etc.). Essential features include: - Registration - Team creation and player management - Tactics creation - Transfers - Game simulation - Leagues system. Preferred technologies are JavaScript and C#, but others are acceptable. I'm also open to offers for partially finished games.
I'm in...proficient Python developer who can help compile a Python code, that I have acquired from GitHub, into an executable format for Windows. As the client, I expect: - Understanding the existing Python code and its dependencies - Transforming the Python code into a Windows executable file Successful freelancers should provide a detailed project proposal illustrating how they plan to compile the code to exe on a Windows operating system. Though no specific Python libraries or frameworks were mentioned, a background in Python coding and debugging is paramount. The ideal freelancer should have a deep understanding of Python code, dependencies, and experience dealing with code from GitHub. Experience in generating Windows executable files...