Vb.net for each item in list punët
Pershendetje une jam Agroni nga Kosoava, a' mundesh ta programojsh nje Heighscore-List per nje Kuiz, Kuizin e kam ble te gatshem ne ket link: pra kur nje User e ka perfundue kuizin rezultai dergohet ne Database automatikisht, deri ketu eshte ne rregull ashtu si duhet te jet, por une jam i interesuar qe rezultati pasi te arrin ne databese te krijohet nje llojj liste me personat qe kan luajtur ne kuiz, pra nje renditje sipas poenave te arritura, perafersisht si ne ket link: login me username e ka quizi paraprakisht te interguar, nese je i interesuar te meresh me ket projekt te vogel lajmrohu!!!
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
Tengo un error en codeigner con la api de mikrotik , necesito hacer funcionar este script corrigiendo este error: }catch(Exception $e){ return $e->getMessage(); } } } } // Mi...funcionar este script corrigiendo este error: }catch(Exception $e){ return $e->getMessage(); } } } } // Mikrotik API if (!function_exists('mkClient')) { function mkClient() { return new PEAR2NetRouterOSClient(settings()[0]->mkipadd, settings()[0]->mkuser, settings()[0]->mkpassword); } } // Mikrotik API Util if (!function_exists('mkUtil')) { function mkUtil() { return new PEAR2NetRouterOSUtil(mkClient()); ...
I urgently need experienced video...product demonstration and testimonial videos for my ecommerce website. - Your tasks include creating clear and attractive product demonstration videos that are less than a minute long, highlighting key features of each listed item. - Additionally, authentic and convincing testimonial videos, also under a minute, are necessary to act as social proof and increase potential customer trust. Individuals applying for this job should ideally possess: - Knowledge in ecommerce and high-level skills in videography. - Efficiency and speed as the job has a tight deadline. - Creativity to make the videos engaging and unique. If you're avid about building brand perception and establishing trust through vi...
Hi there. I'm running XCode 15.3 and I need a few pages done with simple, clean storyboards and View Controllers. I use Alamo Fire and Swift, so if you could use that to pull my dat...running XCode 15.3 and I need a few pages done with simple, clean storyboards and View Controllers. I use Alamo Fire and Swift, so if you could use that to pull my data via my API links and display it in several pages that would be great. Categories > Collections > Items > Item Details You select one and it shows a list - Item Details is one record from a MySQL db I need each selected item to be a variable in the code of the ViewController so if I use the print function, I can see it at the bottom of XCode. I'll give you the 3 or 4 API ...
I am looking for an experienced developer to create a user-friendly web application. Users will upload two images: a headshot and an image of an item of clothing, and the AI will combine these to create a natural, realistic image of the person in the clothing. Key Features: - User-friendly image uploading: The primary focus of the first version of the web app is to allow easy image upload for users. - Basic options to select the type of clothing fit: Users should be able to provide basic inputs related to the clothing, such as size or fit, before the AI generates the final image. Ideal Skills: - Proficiency in AI image processing and manipulation - Web development experience, particularly in user-friendly interfaces - Understanding of e-commer...
I'm in search of a skilled .Net mobile developer to finalize my .Net Maui mobile application. The key tasks include: - Implementing the logic, specifically around user interface interactions. - Although user authentication, data synchronization, and push notifications were not explicitly mentioned, familiarity with these aspects would be advantageous for potential troubleshooting or further development. The mobile application is already well underway, with views, and a nearly finalized backend. Therefore, I need a freelancer who is proficient in both .Net and Maui and can confidently complete the application. Ideal skills and experience: - Proficiency in .Net and Maui - Experience in mobile application development - Und...
I'm in need of an experienced developer to provide long-term maintenance for my e-commerce website. The ecommerce is up and running and fully operational and we need a FULL STACK developer that can code in ALL AREAS of the webapp. - Frontend: React (JavaScript) - Backend: Node.js - Services: Python - Database: MySQL RESPONSIBILITIES: - Integration of new B2B APIs - New payment gateway integration - - Implementation of bug fixes and performance improvements. - Regular software updates and security patches. - Feature additions and enhancements. Skills and Experience: - Proven experience in maintaining e-commerce solutions. - Proficiency in React, Node.js, Python, and MySQL. - Strong problem-solving skills. - Excellent understanding of software best...
I need ONE PAGE created for web store (wordpress/woocommerce). Must have a visual product customizer. Meaning that a customer will have the option to customize the item and see the changes they make in real time. Not just colors and sizes though, but entering texts and choosing adornments, etc. Here is an example of what I am needing (not my website, just one I found online). If you can duplicate this page exactly I would be pleased.
...Mode Setup**: The primary focus of this project is to create a distinctive survival mode suitable for a smaller player base. - **Unique Items**: I will need engaging, custom, and unique items for players to discover and utilize in the game. - **Crate Rankups Integration**: I also want to include a crate rankups system to add a layer of progression and reward for players. Ideal Skills and Experience: - **Minecraft Server Administration**: Experience in setting up and maintaining Minecraft servers is a must. - **Plugin Development**: Proficiency in developing Minecraft plugins is highly desired, specifically for creating custom items and integrating rankups system. - **Game Design**: A knack for game design and balancing woul...
...looking for a professional developer to create a comprehensive and user-friendly dashboard for tracking my crypto investments. This won't be a public app. It's for my personal use only. I will provide the front-end elements (React) most of the work is for adding functionality and back-end. Key Features (I have API from CoinStats for these): - Real-time Price Updates: The dashboard should provide real-time updates on the prices of various cryptocurrencies. - Portfolio Balance Overview: I need to have a clear overview of my overall portfolio balance. - Transaction History Tracking: This feature will allow me to keep track of all my transactions in the crypto market. Additional Pages: - Indicator Tracking: An essential feature that sh...
I am in search of a skilled .NET Core developer to work on a project for me. As the client, I'm looking for someone who can bring the following to the table: - Proficiency in .NET Core: Given that my project is based on this technology, familiarity and experience with it is a must. - Application Development Experience: Previous experience in developing web applications would be particularly beneficial. - Strong Problem-Solving Skills: The ability to troubleshoot issues and devise solutions is key. - Attention to Detail: It's important that our project is implemented correctly and accurately. The ideal candidate for this project would be someone who understands the nuances of .NET Core, has a good track record in...
I'm seeking a proficient developer to create a custom side navigation menu using TailwindCSS and AlpineJS. The main purpose of this menu is for navigation on our website. Key Requirements: - Layout: The navigation menu should be styled in a vertical layout on the side of the screen. - Interactive Features: It should include collapsible submenus, enabling the user to expand or collapse menu items as needed. Additionally, each item should have a distinctive active state indication. Ideal Skills and Experience: - Strong understanding of TailwindCSS and AlpineJS, including their application in building custom navigation menus. - Familiarity with creating effective and user-friendly interactive features such as collapsible submenus and active state indi...
I currently need an experienced industrial designer who can help me perfect a textile net for my product designed for basketball practice. Online, the main task will be to take the prototype of my existing product and make improvements through computing and then send it to be manufactured.
Full Stack .NET Core Developer Needed to develop our whats app api platform A basic requirement is that he has previously worked on the WhatsApp API platform. I can review it before starting work
...our stack which are a HUGE ADDED BENEFIT if you can work on them -> .NET ASP, WEB API + MS SQL DETAILS HERE -> PRIORITY IS TO HAVE A DEVELOPER ON OUR TEAM (LONG TERM) THAT CAN FOR NOW ALSO WORK WEEKENDS AS WE HAVE SEVERAL EMERGENCIES TO FINISH URGENTLY. Someone who can efficiently manage Linux VPS and efficiently use GITLAB is critical. Initially we need part of the hours to be worked in the first weeks from 8:00PM- 2:00am UTC -3 (Brazil Time) later you can work on your time zone. Prerequisites: For the long term project the *STARTING* wage will be as stated below. 1) Accept initial hourly rate of U$5.00 2) If awarded, accept and start work IMMEDIATELY 3) Have MINIMUM OF 20+ hours a week for long term ongoing support and development. ...
I'm in need of a dynamic Android application that will enable users to virtually 'try on' clothing items using their device's camera. The app should be compatible with both Android smartphones and tablets, and its primary functionality should be a virtual fitting room. Key Features: - Device Compatibility: The app should be designed to work seamlessly with both Android smartphones and tablets, ensuring a broad range of users can enjoy the experience. - Virtual Fitting Room: The core element of this app is its ability to allow users to try on clothes virtually. This should be an engaging and realistic experience for the user, helping them to visualize how an item would look on them. - Real-Time Interaction: Users should be able to use their device...
I'm in immediate need of a skilled web developer to tweak an existing custom-built script for my car rental website. The script that I am using is this: I am looking for a professional with a high level of expertise in web development to make these adjustments quickly and effectively. The priority is the rapid completion of this project, so it is critical that the selected freelancer has the bandwidth to dedicate to this task immediately. Experience with custom-built scripts is a must. Your portfolio should demonstrate your capability to work on existing structures and adapt them to new requirements.
...HAVE A DEVELOPER ON OUR TEAM (LONG TERM) THAT CAN FOR NOW ALSO WORK WEEKENDS AS WE HAVE SEVERAL EMERGENCIES TO FINISH URGENTLY. We will start with 5-10 small task in and then go to some smaller .NET tasks all with 1 day sprints for you to become familiar with the software and then our main goal will be to integrate another B2B API for our MVNO. Initially we need part of the hours to be worked in the first weeks from 8:00PM- 2:00am UTC -3 (Brazil Time) later you can work on your time zone. If you are awarded the task we expect you to accept IMMEDIATELY and if the project is not accepted immediatly we will award it to another developer. To qualify you must be full stack and work PROFICIENTLY with gitlab and code in ., .NET ASP,...
...services. This is the script page detials - Key requirements include: - Functionality Enhancements: I'm looking to improve the app's current functionality significantly. While I haven't specified the exact enhancements needed, your ability to understand the app's existing features and suggest or implement improvements will be crucial. - Third-Party Integrations: I have a specific list of third-party services that I want to integrate into the app. Your experience with integrating external services into Flutter apps will be essential. Skills and Experience: In order to be successful in this role, you must have: - Demonstrated expertise in Flutter development, with a strong portfolio of apps you've worked
I'm looking for a professional to develop a sophisticated website for my pizzeria and restaurant. The cornerstone feature will be a detailed, image-based menu. Here are some specifics to take into account: - Menu Display: The menu should be extensively detailed, making use of high-quality images for each item. This should tangibly enhance the appeal of our vast array of dishes and entice website visitors. - Food Categories: The menu will need to accommodate more than 10 diverse categories. The design should ensure effortless navigation despite the extensive variety. Ideal Skills and Experience: - Prior experience designing food-related or restaurant websites - Proficiency in creating enticing, image-based digital menus - Ability to structur...
I'm looking for a skilled web developer to create a fully functional e-commerce website with the following features: - User Registration and Login: Users should be able to register, create an account, and log in securely. - Item Listing for Sale: Registered users should be able to list items they want to sell. - Online Purchasing: A system that allows users to purchase items online, similar to Amazon's process. The website should also have: - Search and Filter Functionality: Users should be able to search and filter the items listed for sale. - Seller Rating System: A rating system for sellers to help users evaluate and choose trustworthy sellers. Ideal skills for this project include web development, e-commerce platfor...
I'm looking for a skilled freelancer to develop a customized net worth spreadsheet. This spreadsheet should enable me to meticulously track my financial progress across various categories. Key Requirements: - The spreadsheet should allow me to input and monitor: - Investments (especially individual stocks) - Debt - Savings - Income - Expenses - Other category for miscellaneous expenses or income - I require a simple, user-friendly design that makes manual data entry easy and intuitive. Skills and Experience: - Proficiency in spreadsheet software such as Excel or Google Sheets is essential. - Experience in financial tracking and net worth management is highly beneficial. - Understanding of stock market, investment tracking, an...
I'm looking for programmers with solid experience in DeFi app development, particularly related to Liquidity pools, Yield farming, and Staking rewards. Key requirements for this project: - Creating a DeFi application that incorporates the above-mentioned features. A fully automated platform, that searches for highest return per transaction, and yet lowest or no risk opportunities in , liquidity pools , arbitrage of all sorts, staking, yield farming and any potential combination to achieve same goal. Ideally, this will be a platform similar to Krystal, but with the added features of above automation based on user request for each item of opportunity. Software must be able to find, on all existing platforms and exchanges these opp...
I'm working on a project using Ignition 8.1.31 and need a feature implemented. The goal is to have a dropdown list in the perspective view that allows the user to select files from a specified directory. Key Points: - The dropdown should be populated with the file names upon the user clicking a perspective View button. - The Load button should be located on the perspective view. The ideal freelancer for this job should have experience with Ignition 8.1.31 and familiarity with creating dropdown lists that are dynamically populated based on user interactions.
Hello, I have my Python/Django site hosted on PythonAnywhere and it's facing a NET::ERR_CERT_DATE_INVALID issue. Website : I would appreciate someone help to troubleshoot this issue and fix the NET::ERR_CERT_DATE_INVALID error, ensuring that the SSL/TLS certificate is correctly set up. - Website troubleshooting and error resolution - SSL/TLS certificate configuration. Thanks in advance !
I'm seeking an experienced DevOps engineer who is proficient in deploying React Frontend and .NET Core 8 applications to Alma Linux with NGinx server. The candidate should have solid experience with: - Deploying React FrontEnd and .NET Core 8 Web API applications on Alma Linux in GoDaddy VPS. - Knowledge of routing of both applications with one domain and one SSL. - Knowledge of handling SubDomain. - Knowledge of Alma Linux Nginx deployment. - Understanding of .NET Core Application Settings and React.JS application settings - Understanding of Node.JS
I ...individual with experience in compiling email lists to help me create a targeted list of small businesses in Australia for my email marketing campaigns. I will provide the business types I'm interested in: retail stores, restaurants, and service providers. Key Responsibilities: - Research and compile a comprehensive email list of small businesses across Australia, specifically in the retail, restaurant and service provider sectors. - Ensure the list is accurate, up-to-date, and segmented according to the provided business types. Ideal Candidate: - Experience in creating targeted email lists, particularly for small businesses. - Familiarity with Australian small business landscape. - Attention to detail to en...
I'm looking for a freelancer to help me with email scraping to build a targeted email list in the education sector. Specifically, I'm interested in parents who are seeking tuition services for their children. Key Responsibilities: - Conducting research online to identify and extract email addresses of parents seeking tuition services for their children - Organizing the list in an easily accessible format that I can utilize for email marketing campaigns Skills and Experience: - Proficiency in email scraping and list-building - Prior experience in targeting the education sector is desirable - Understanding of lead generation and email marketing best practices
I'm in need of a dynamic Android application that will enable users to virtually 'try on' clothing items using their device's camera. The app should be compatible with both Android smartphones and tablets, and its primary functionality should be a virtual fitting room. Key Features: - Device Compatibility: The app should be designed to work seamlessly with both Android smartphones and tablets, ensuring a broad range of users can enjoy the experience. - Virtual Fitting Room: The core element of this app is its ability to allow users to try on clothes virtually. This should be an engaging and realistic experience for the user, helping them to visualize how an item would look on them. - Real-Time Interaction: Users should be able to use their device...
ALL PHP script of the configurations and parameters of the site /////CONFIG AND INSTALL SCRIPT //// I want a complete configuration of all parameters URL DEMO SCRIPT. 7437.Cj0KCQiA5rGuBhCnARIsAN11vgR0IAOeV3fZLehJ28mJeOVeC35qXrrXFJfbYhlUK8e9nraqPybSIxUaAic2EALw_wcB .................................................. ................ ......... I want a complete script setup with all systems working. CREATION OF ACCOUNTS AND EMAIL ADDRESSES TO MAKE THE WHOLE SCRIPT WORK example add: :add languages EUROPE AND ENGLISH : account creation, facebock, instagram, twitter X, (create an email address on the domain)
I need a skilled .Net MAUI developer to assist me with my existing project. The main tasks for this project include: - Fixing bugs: The project is currently experiencing some issues which are negatively affecting the user experience. The specific bugs are not provided in this brief, but I can share details during our discussion. - App Publishing: Once the bugs are resolved, you will be responsible for publishing the updated version of the app to both Android and iOS stores. - Delivery of the final source code and making sure it is running on our machine. The ideal freelancer for this project should: - Have a proven track record in debugging and resolving issues in .Net MAUI projects. - Be proficient in the publishing pro...
Current project is built on Laravel for both front and backend. Need to build React frontend to replace Laravel frontend side. All the pages inside current pages should be moved to React with new template UI and all same functionalities. Main Laravel frontend back end Login this saas/superadmin version (include All modules) USE THIS Admin TEMPLATE FOR Frontend Current system making this stacks - Laravel, MySQL, VueJS, JQuery & Bootstrap, DOCUMENTATION API DOC
I need assistance with extracting specific data from a voter list that comes in PDF format from the election commission. Here’s what I need: - Extract Name, FathersName, Age, Gender, VoterID, and SerialNumber from the PDF voter list. - Placement in a standard Excel format is acceptable, no need for any specific formatting. - Not just a one-time service, I also need a software or script that can perform this PDF-to-Excel conversion automatically in the future. Ideal candidates for this project have advanced skills in data extraction, familiarity with handling election data and proficiency in developing an automated system for convenient PDF to Excel conversion.
I am in need of an experienced graphic designer to create product packaging labels for my medical items. These labels will be for medium-sized packaging, and they do not need to be waterproof. Key Requirements: - Create visually appealing and professional product packaging labels - Prior experience in designing product labels, especially for medical items, is a plus - Ability to deliver high-quality, print-ready designs in a timely manner - Understanding of SFDA regulations for medical product labels is preferred - Experience with medium-sized packaging is important The ideal freelancer for this project should have a strong portfolio of label design work and should be able to demonstrate their understanding of the nuances of design...
the price is changing as the quantity of the purchase, I want to make it change depending on something else I have in mind the plugin is already purchased and it is this plugin
I'm looking to create an Android app primarily for use by my distribution staff. The app will serve as a tool for them to order products and for me to monitor their movements. Key Features: - Product Catalog: The app should contain a list of products available for ordering. This would ensure that my staff have a clear understanding of what's in stock. - Order Placement: The platform must allow my staff to place orders with ease. This should be a seamless and quick process. - Live Tracking: I would like to track the movements of my distribution staff in real-time. This feature is crucial for me to ensure efficient delivery and to track their performance. The ideal candidate for this project will have experience i...
Ideal Skills and Experience: - Proficient in C# programming language and .NET framework - Experience in developing desktop applications - Familiarity with Visual Studio - Ability to implement data encryption and database integration - Expertise in developing secure user authentication mechanisms Please provide relevant examples of your previous work in C# desktop application development.
we have made a scan for a wordpress site and there are some elements that are taking more time to load that it should, thus slowing down the website and loosing google ranking. The item with the highest content playback 15,750 ms Remove resources that block playback You can save 2850ms Stream images in modern formats You can save 2,205 KiB Minimizes main thread processing 2.7s Encode images efficiently You can save 1,577 KiB Reduce unused CSS content You can save 63 KiB Size images correctly You can save 118 KiB Those are the results from scanning that should be fixed. Small project, bid should be final bid. No bid increase possible after placing bid !
...The website should cater to individual investors, small business owners, and high-net-worth individuals. Key Features: - Detailed and clear information about my advisory services: Candidates with experience in creating informative and engaging content relating to finance or investments will have an advantage. - An investment portfolio section: The ideal freelancer should demonstrate an ability to elegantly display financial data in an accessible manner. - A contact form: Allow visitors to submit inquiries directly through the site. - An investment calculator: This needs to be user-friendly and visually appealing, requiring both frontend and backend capabilities. Ideal skills and experience: - Proficient in front-end and back-end development. - Demonst...
Hello! We're excited to launch "ZeenaSilk," a new luxurious bracelet line, and we're seeking a talented designer to create a unique visual identity for our brand. Here’s what we need: 1. **Brand Identity and Packaging Solutions:** - Develop a complete branding suite, including enhancing our base logo (which will be provided), and designing packaging, bags, boxes, and color schemes. We need innovative and practical solutions that reflect the luxury and uniqueness of our products. 2. **Bracelet Holder Card Design:** - Design customized bracelet holder cards for 10 different bracelet concepts, each telling a unique story. For example, one of our designs, "Desert Glow," is inspired by the serene and vibrant hues of the de...
...automated solution for generating proposal quotes. This is currently done manually and is a pdf document. Looking to improve efficiency and reduce potential errors. Requirements: - Experience in automation software development - Great attention to detail to ensure error-free output - Familiarity with creating user-friendly interfaces Project Details: - The system should automatically generate item descriptions, quantities, and prices for our proposals. There currently is no database. Items are manually added per proposal. We require a database to pick the products and add as required to the proposal. This would also require updating and potentially integrating with a website. - The solution should be easy enough for anyone to use, without specialize...
I'm looking to create an extensive database of rice mills in India that includes essential information like Name, Address, Contact, Email and GST details. This data will be used for sales outreach, so each entry needs to be thorough and accurate. Key deliverables: - Compilation of data in a spreadsheet format. - Each entry must include the rice mill's Name, Address, Contact, Email, and GST details. Ideal Skills and Experience: - Proficiency in data collection and organization. - Strong attention to detail and accuracy. - Prior experience in market research, data mining or similar projects. - Knowledge of the agricultural industry in India would be a plus, but not required.
...looking for an experienced and well-connected individual who can collaborate with me to source high-end individuals for a unique project. Key responsibilities: - Sourcing Billionaire Club Presidents: Utilize professional networking sites, exclusive events, direct outreach, and connections to identify suitable candidates. - Running Portfolios: Coordinate the portfolios of these individuals, tracking their performance and making strategic adjustments as needed. - Generating Portfolios via Events: Plan and execute events that attract potential club presidents and generate new portfolios. The ideal candidate should have: - Proven experience in sourcing high-net-worth individuals - An existing network in the business and finance world - Strong project ma...
Project Description: I am seeking an experienced freelancer to develop a directory listing website, similar in design and functionality to the following template: The design will be provided by me. Requirements: 1. Technical Specifications: - Framework/Technology: Please suggest suitable technologies. - Database: MySQL, PostgreSQL, or another relational database. - Responsiveness: The design must be fully responsive and work flawlessly on all devices (desktop, tablet, smartphone). - SEO: It must be possible to optimize each individual listing for SEO, as well as the overall website. - Security: Implementation of security measures to protect user data. - Performance: The website must load quickly
I'm looking for someone to help me create a list of 2000 industry specific business contacts, particularly names, company names, position, location information and email addresses. I would like this list to be compiled through online research only. Key responsibilities: - Researching and compiling a list of business contacts - Ensuring all email addresses are verified and duplicates removed. Note: The focus should be on getting accurate, up-to-date information.