Asp net cms vb punët
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
Modify packing list in opencart cms 40usd. start now quick job!!
Modify packing list in opencart cms 40usd. start now quick job!!
Modify packing list in opencart cms 40usd. start now quick job
Modify packing list in opencart cms 40usd. start now quick job
Modify packing list in opencart cms 40usd
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
I'm in need of a professional who can review and optimize my .net Core 6 codebase, enhance the software architecture, and bolster the database security. Key Responsibilities: - Conduct a comprehensive code review to identify inefficiencies, bugs, and areas for improvement in the .net Core 6 code. - Improve software architecture to ensure scalability, maintainability, and performance of the application. - Implement robust measures to enhance the database security, in line with industry best practices. Ideal Skills and Experience: - Extensive experience in .net Core 6 and Entity Framework. - Proven track record of conducting code reviews and optimizing codebases. - Expertise in software architecture design and implementation. - Strong understanding of database se...
...integrate the logo to strengthen brand identity. Font: Consistent use of the Gotham font for text elements to maintain a uniform appearance. Layout: Clear, user-friendly navigation with a main menu bar that includes pages for "Home," "About Us," "Services," "Contact," and legal pages. Responsiveness: Optimize the website for all device types to appeal to a broad user base. 3. Technical Requirements: CMS: Use WordPress (or others) with appropriate security plugins and regular backups. Hosting and Domain: Recommendation for reliable hosting that meets web traffic and data security requirements. Privacy and Security: Setup according to Swiss data protection regulations, including a cookie policy and SSL encryption. 4. Content Requirements: ...
Necesito un programa escrito en vb en el framework .net 4.6 y que utilice windows form para la siguiente tarea: > Credenciales del servidor FTP direccion: ftp:// user: android password: android > Descripcion de las rutas del servidor FTP donde el primer path / se ubicaran carpetas con años 2021,2022,2023 hasta la actualidad, ejemplo ftp://, ftp:// en el segundo path / seran carpetas con los meses del año representados con numero 1,2,3... ejemplo ftp://, ftp:// en el tercer path / existiran carpetas con los RFCs de los clientes con un formato similar a este IVD920810GU2, ejemplo ftp://, ftp:// dentro de este
I have a general idea of what I want to achieve. I have done similar thing in the past and can demonstrate to explain the goal. I’m looking for someone which obviously knows winCC and able to write VBS code to achieve goal
...warehousing concepts, ETL development, data modeling, metadata management and data quality Strong knowledge of SQL running on SQL Server, MySQL, and Snowflake including but not limited to: extensive experience working with complex stored procedures, table definitions, and a proven track-record of performance optimizations and troubleshooting of SQL logic. Proficient at C# running on .NET Core and/or other similar .NET frameworks including but not limited to: writing Unit Tests and implementing algorithms and data structures Strong hands on experience in Microservices, RESTful webservices development in Java (Spring Boot or equivalent framework) Proficient at building intelligent solutions to complex problems. Experience using source control tools such as GIT Proficient at ...
I am about to start a Copywriting Business, and I wanted help setting up a Website to market my services. - I am completely fine with using a template - I will write the copy - I want the website to be easy to customize and change over time - I want complete control over the backend - I'm open to using WordPress, Ghost or any other CMS that makes sense.
Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.
...capable .NET developer to create a WebAPI using the Visual Studio template "WebApi Net core (Minimal api)". It needs to have Authentication and Authorization in place, using the X-API-Key. Key Requirements: - Authentication and Authorization: You need to enable X-API-Key based authentication and authorization for this WebAPI. - Data Model: The WebAPI will manage a simple 'City' table, performing basic CRUD operations. Expectations: - The X-API-Key should be hardcoded in the application. - The WebAPI should be developed using .NET 8.0 and the Visual Studio template "WebApi Net core (Minimal api)". - Data access should be implemented using EFCore. - Authorization should be handled through middleware. Ideal Skills and Experie...
I am looking f...skilled web developer to create an informational website targeted towards businesses. This project requires a website that can easily be updated with regular product/service updates, since it'll be a platform to educate our audience about our offerings. Key requirements for this job: - Comprehensive web design and development expertise - Proven experience integrating a content management system (CMS) for easy content update - Knowledge in creating a user-friendly layout for businesses - Strong understanding of SEO strategies to help us reach our target audience effectively Please provide samples of similar websites you have developed, especially ones targeted towards businesses. Candidates with previous experience in building informational websites will hav...
I am seeking an experienced .NET developer to build a highly dynamic REST API using the .NET 8 framework. The API will be designed to manage interactions with a database using a single, generic controller capable of handling all database tables. This project will involve implementing advanced features such as column selection, filtering, sorting, pagination, and complex table relationships like aggregations and master-detail references. Core Requirements: 1. API Framework: The API should be developed using .NET 8. I am open to using either OData or GraphQL for the API architecture, depending on what the developer finds most suitable for the project requirements. Alternative suggestions are welcome for discussion. 2. Generic Controller: The API should feature a single...
E-Commerce Site Development with PayPal and Stripe Integration I'm looking for a skilled web developer to create an e-commerce website for my busine...catalog. Ideal Skills and Experience: - Proven experience in e-commerce website development, particularly for small to medium-sized businesses. - A strong background in using and integrating payment gateways such as PayPal and Stripe. - Solid understanding of user experience (UX) and user interface (UI) design to optimize the site for conversions. - Ability to create a content management system (CMS) that's intuitive and efficient for managing product listings. - Excellent communication skills to ensure a smooth collaboration and the ability to implement feedback effectively. *Skills Required PHP Website Design Shopping C...
I'm looking for a Facebook Ads expert who can help me generate leads. Key Requirements: - Experience with lead generation campaigns on Facebook - Proficient in targeting older demographic (65+) with high net worth - Ability to focus on a specific local area I'm in need of someone who can craft ads that speak directly to high net worth adults in a specific local area. The primary goal is to generate leads, so it's crucial that the ads are not only engaging but also have a clear call to action that encourages these individuals to express interest in my services. It's very important that the freelancer has a deep understanding of Facebook Ads, including the platform's ad targeting capabilities. Previous experience with similar campaigns targeting a s...
The purpose of this project is to write Visual Basic .NET code that interacts with the PayPal API to generate payments What I need: that will: - Obtain the access_token using OAuth2. - Create a payment. - Execute the payment. will: - Retrieve the response triggered by PayPal and process it accordingly by determining if the payment was successful or not. - If the payment wasn't successful, display a message saying that no payment was made. - If the payment was successful, display the details of the operation returned by PayPal. If you want to participate to this project please copy/paste this sentence in your bid "I have been working with PayPal API and I have got proficiency in Visual Basic .NET"
Design and Implementation of an Application and Website Responsive User Interface (UI) Design: Ensure that the design functions smoothly and responsively on various devices such as desktop computers, tablets, and smartphones. Content Management System (CMS): A scalable database that allows easy addition, editing, and deletion of content. An easy-to-use management interface that allows instructors to efficiently manage courses and content. Student Management and Registration System: Capability for students to register and log in to their personal accounts. Detailed information about course progress and outcomes. Secure Payment System: Integration with trusted payment service providers such as Apple Pay and Mada, among others. Ensure that payment transactions are conducted securely a...
I'm looking for a skilled developer to create a business website, and I'm open to using either PHP or .NET. Key requirements for this project include: - Implementation of a robust and user-friendly payment gateway integration for seamless transactions. - Integration of a feature that allows businesses to list their business for sale listing on the site. Your experience with development and payment integration will be crucial. Please share relevant experience and approaches in your proposal.
I'm in need of a professional who can create a chic and user-friendly blogging website for me. The ideal candidate should have: - Proficiency in web development and design, with a focus ...in need of a professional who can create a chic and user-friendly blogging website for me. The ideal candidate should have: - Proficiency in web development and design, with a focus on blogging websites. - Strong understanding of user experience and ability to create an engaging platform. - Ability to complete the project within 30 days. While I did not indicate a preference for a particular CMS, expertise in popular platforms such as WordPress may be advantageous. Your ability to understand my vision and translate it into a dynamic blogging site will be key. I look forward to seeing ...
I'm in need of a web developer to create a static website using WordPress as the CMS. This website is primarily intended to showcase my products, hence, the inclusion of various features to enhance this purpose. Key Features: - Content Management System (CMS) using WordPress - Product categories: up to 5 categories - Dealer inquiry form - Home page banner - General inquiry form with a captcha - Slider functionality - No shopping cart or payment gateway - Articles section Ideal Skills: - Proficiency in WordPress and static website development - Experience in creating CMS-driven websites - Graphic design ability for home page banner - Understanding of product showcase and dealer inquiry integration - Expertise in implementing sliders and captcha functionalities ...
Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.
I'm in need of an experienced .Net developer, with solid skills in MSSQL and C#, who can effectively handle front-end development tasks in my POS terminal project. Your primary tasks will be: - Implement business logic based on defined user stories. - Develop the user interface of the POS terminal using C# and associated .NET technologies. - Integrate the POS terminal with MSSQL database for data storage and management Ideal skills and experience: - Proficiency in .Net, MSSQL, and C#. - Previous experience in front-end development. This role requires both technical expertise and keen attention to detail. I am looking forward to your innovative solutions to meet our project requirements.
Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.
I am in need of an experienced full stack developer who is well-versed in .NET and Angular to assist with the backend and frontend development of my project. Essential Tasks: - Involvement in both backend and frontend development processes - Providing valuable insights during project reviews Key Skills: - Strong competence in .NET and Angular - Proven experience in full stack development - A strong grasp of cloud technologies is advantageous - Excellent communication skills, as understanding and following project requirements are crucial Project Timeline: - There is no strict time frame for completion of this project. We value quality deliverability and careful attention to detail above speed. Ideally, you have a portfolio of previous projects to demonstrate your com...
I'm seeking a skilled developer with expertise in .NET and Angular to take part in my ongoing web development projects. The main goal of the project is to enhance an existing application. Requirements: - Proficiency in .NET for backend development - Strong experience with Angular for frontend development - Excellent understanding of SQL Server and MongoDB databases - Previous work with DevExpress is essential Your responsibilities will include: - Developing APIs using .NET for enhancing the application - Integrating Angular for improving the frontend - Ensuring seamless operation with SQL Server and potentially MongoDB Ideal candidates should have a strong understanding of web development and be able to contribute effectively to enhancing the current state o...
I want to change jobs and I am looking for specific positions that match my profile. Due to my current engagements, I don't have enough time to research all HR job posts on the net, so I am looking for a skillful Recruitment Specialist and HR Generalist. The main sources of info would be LinkedIn and Indeed and other job platforms - we will discuss. My requirements for the position are very specific. I have a LinkedIn profile. I research myself too, but I feel I don't put enough time. The task is to find jobs posts matching my profile and the requirements that I will provide, and to input all the results in a spreadsheet. Work time: once a week for about 2 hours, or twice a week for about 1 hour. Required Skills: - Prior experience in HR or recruitment - Much experi...
Hi, Job Title: Senior Developer - SQL Se...business intelligence and data analytics requirements. Tasks involve creating data models and developing multidimensional cubes. Key skills required: expertise in MS SQL Server Analysis Services (SSAS) Tabular and Multidimensional. Proficiency in TSQL for writing performant queries is essential. Experience with data visualization and reporting tools is highly valued. Additional knowledge of Excel and .Net development is advantageous. Strong problem-solving abilities, excellent communication skills, and a collaborative mindset are desired traits. Developer has to be at the ON SITE Dubai office. - Work Location - Dubai - Number of Working Days - 6 days ( Monday to Friday ) - Number of Working Hours - 10hrs per day - N...
I am seeking the developer with advanced skills in API implementation, with specific experience with the BnP Paribas' API structure, as well as a strong proficiency in C# .NET. Project duration 3 months. Spoken language Greek. Key Responsibilities: - Establish a robust connection between our application and the BnP Paribas via their API. - Ensure successful transmission of specific data, Cash Account Info, Securities Account Holdings, Settlement Status, Transactional – FX.. Required Experience: - Strong proficiency in C# .NET - Proven experience in API Integration, preferably with BnP Paribas - Knowledge of JSON data format - Proven ability to work according to specifications and deadlines - Ability to test and troubleshoot the integration This project involves...
I'm in search of an experienced Laravel developer who can construct a robust and user-friendly content management system (CMS). The CMS should focus on three core components: 1. User Management: Features should include capabilities for user registration, login, and a system for establishing user roles and permissions. 2. Content Publishing: A key factor is the integration of a WYSIWYG editor for efficient content creation and publishing. 3. Media Management: A media management component is vital for smoothly handling and organizing various forms of media on the platform. The ideal candidate should have in-depth knowledge of Laravel and extensive experience in CMS development. They should also have a solid understanding of media management systems and user-cen...
...Wireframes/mockups for homepage and 3 additional pages (About Us, Services, Contact). - Presentation of designs for feedback and revisions. - Finalized design mockups based on approval. 2. **Development Phase:** - Development of approved designs into a fully functional website. - Use of modern web technologies (HTML5, CSS3, JavaScript). - Integration of a Content Management System (CMS) for easy content updates (e.g., WordPress etc). - Responsive layouts for compatibility with various devices. - Features: Contact forms, image sliders/galleries, social media integration (links/icons), WhatsApp support. - Implementation of lead/visitor alerts for monitoring website activity. - Testing across browsers/devices for functionality and responsiveness. - Tra...
...additional pages (About Us, Services, Contact, Quote Form, work with us, vendor/ supplier). - Presentation of designs for feedback and revisions. - Finalized design mockups based on approval. 2. **Development Phase:** - Development of approved designs into a fully functional website. - Use of modern web technologies (HTML5, CSS3, JavaScript). - Integration of a Content Management System (CMS) for easy content updates (e.g., WordPress etc). - Responsive layouts for compatibility with various devices. - Features: Contact forms, image sliders/galleries, social media integration (links/icons), WhatsApp support. - Implementation of lead/visitor alerts for monitoring website activity. - Testing across browsers/devices for functionality and responsiveness. ...
...seeking a skilled developer to create a web application using .NET Core. This role involves a primary focus on building a robust, user-friendly web app. Ideal Skills and Experience: - Proficiency in .NET Core - Previous experience with web application development - Understanding of best practices in software design - Familiarity with integrating Payment Gateway APIs - Strong problem-solving and communication skills Key Deliverables: 1. Develop a web application using .NET Core that meets our specifications and requirements. 2. Implement Payment Gateway integration within the application for seamless transactions. 3. Ensure the web application is optimized for performance and is secure. If you have a proven track record in building .NET Core web applicatio...
I need a seasoned ASP.NET VB developer with a strong background in updating existing applications. You will be responsible for enhancing and improving the functionality of our current system. Ideal Skills and Experience: - Proven experience with ASP.NET VB - Competence in updating and maintaining existing applications - Strong problem-solving skills - Excellent communication and teamwork abilities Your application should clearly demonstrate your experience with updating existing ASP.NET VB applications. Please don't hesitate to include links to relevant past work.
I'm looking for a skilled developer to create a C# web application. Key Requirements: - Fluency in C# programming language - Proficiency in web application development - Experience with .NET Core, Xamarin, or Unity frameworks is a plus - Familiarity with web application technologies and best practices It's a plus if you have prior experience in building web applications, but not necessary. The most important aspect is your ability to understand and implement the project requirements effectively. A good grasp of C# and web programming is a must.
Ease and flexibility of use by the site administration. - A comprehensive control panel for dynamic content management. - Multiple authority levels (manager, editor, publisher, etc.). - An easy and integrated system for managing multimedia (images, video, etc.). - Flexible tools for publishers enabling review and scheduling. - Compatibility with C3W standards for cross-browser functionality. - Possibility of future development without impacting existing content. - An excellent, search engine-friendly system for periodic archiving of content (SEO). - Multilingual support (Arabic - English). - Design meeting standards for speed and ease of browsing. - Sp...
...visually appealing and user-friendly e-commerce website using WordPress. Key Requirements: - E-commerce Focus: The primary purpose of the website is to facilitate online sales. The design should be optimized for showcasing products and ensuring a smooth purchasing experience. - Payment System Integration: The site should be integrated with Paytm and Google Pay to cater to a wide range of customers. - CMS: I prefer to use WordPress as the content management system for its ease of use and flexibility. Ideal Skills: - Proficient in WordPress: A deep understanding of WordPress and its e-commerce capabilities is essential. - E-commerce Design Experience: Previous experience designing successful e-commerce websites is highly desirable. - Payment System Integration: Experience integra...
...is optimized for search engines and meets all accessibility standards. Collaborate with our marketing team to align the website with our promotional strategies. Requirements: PAGES: Home about us White Label Partnership Outsourcing Design & Branding Website Digital Marketing - PPC, SEO, Social Media, Content Marketing Public Relations Video production Blogs Contact us TECH REQUIREMENTS: CMS WordPress WIDGETS AddThis - Social sharing for blogs, social feed) POWR (Or suggest other free ones) - Create contact forms, popups, social media feeds, and image or video sliders) BLOG WordPress ANALYTICS (Might remove some paid ones) Matomo Analytics Leadfeeder Microsoft Clarity Linkedin Insight Tag Google Analytics Facebook Pixel Marketing automation True Push (For push not...
...also. Please no AI stuff, no stackoverflow developers, no "bat inklish". No agencies, only people with experience over 2 years in active development. I would only accept submissions that contain portfolio or skill sets based on these topics: (Web app security, Product management, Search, Emails, Payments, Invoicing, Shipping, Barcode scanner, In-store buyers, Translations, Analytics, Logging, *CMS) Accordingly, the main criteria (IMHO, up for discussion): ✅ Experience in **E-commerce development** (to avoid repeating the same mistakes) ✅ Experience working in a large company / applying principles of successful and long-term development independently (TDD, Documentation, CI/CD ...) ✅ Experience / ability to design DB and application architecture - simple for expansion...
I am looking for a dedicated individual with extensive experience in developing .NET Blazor applications, Experience on working on Healthcare Application will be a plus.
I'm using WordPress as my CMS, and my website is currently verified in Google Search Console. I'm encountering an issue where the file appears to be unreachable. This is concerning, as it can affect how my website is crawled and indexed by search engines. Key points: - The file on my WordPress site is currently unreachable according to GSC. - I need a professional who can help identify the root cause of the problem and provide a solution. Ideal Candidate: - Experienced with Google Search Console and resolving technical issues within it. - Proficient in WordPress and its underlying structure. - Strong understanding of and how it impacts search engine crawling and indexing. - Good troubleshooting and problem-solving skills.
I am urgently seeking an experienced .NET developer who can address some bugs and error messages within my application. As I did not specify the nature of these bugs, the successful applicant should be confident in handling a broad range of potential issues within a .NET framework. Key responsibilities: - Identify and troubleshoot bugs and error messages - Ensure consistent operational efficiency post bug fixes Ideal Skills and Experience: - Strong proficiency in .NET development - A broad understanding of potential .NET bugs - Proven experience in troubleshooting and resolving .NET issues Due to the urgency of this task, a prompt response and quick turnaround time is highly appreciated.
i would prefer Arabic speaker I am seeking a proficient web developer to design a WordPress CMS website for my beauty company. The key purpose of the website will be to share insightful content about the beauty industry, primarily in the form of product reviews. The requirements for this job include: - Advanced skills in WordPress CMS web design in multilingual format (English-Arabic) - Proficiency in creating an engaging and user-friendly interface for content sharing - Experience on other beauty industry websites would be advantageous The successful freelancer will work closely with me to ensure the website accurately fulfills its purpose of disseminating educational content in the beauty industry.
I am looking for a skilled developer with strong experience in AngularJS and understanding of Azure board. Key Responsibilities: - Implement user authentication, form validation, and API integration using AngularJS - Ensure the components are designed in accordance with Material Design Skills and Experience: - Proficiency in AngularJS and .NET is a must - Solid understanding of Azure board is desired - A good eye for design with a preference for Material Design - Prior experience in developing user authentication, form validation, and API integration functionalities is an added advantage. I look forward to your bids.
