Asterisk ami vb net punët

Filtër

Kërkimet e mia të fundit
Filtro sipas:
Buxheti
deri në
deri në
deri në
Lloji
Aftёsitё
Gjuhët
    Shteti i punës
    2,000 asterisk ami vb net punët e gjetura, me çmimin EUR
    Project for Ardit H. Ka përfunduar left

    Pershendetje Ardit, keni eksperience me Suite crm apo Vtiger crm? kam nevoje pernje konfigurim ne lidhje me crm dhe asterisk

    €92 (Avg Bid)
    €92 Oferta mesatare
    1 ofertat
    Programing Ka përfunduar left

    Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc

    €11120 (Avg Bid)
    €11120 Oferta mesatare
    4 ofertat
    Crie um Website Ka përfunduar left

    Desenvolvedor .NET MVC, SQL e ADVPL Protheus

    €2700 (Avg Bid)
    €2700 Oferta mesatare
    1 ofertat
    qefqreqweqawdafsc Ka përfunduar left

    asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr

    €182 (Avg Bid)
    €182 Oferta mesatare
    1 ofertat
    yveguwvcjnjnecbkhb Ka përfunduar left

    ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif

    €104 (Avg Bid)
    €104 Oferta mesatare
    1 ofertat

    I'm in search of a skilled .Net mobile developer to finalize my .Net Maui mobile application. The key tasks include: - Implementing the logic, specifically around user interface interactions. - Although user authentication, data synchronization, and push notifications were not explicitly mentioned, familiarity with these aspects would be advantageous for potential troubleshooting or further development. The mobile application is already well underway, with views, and a nearly finalized backend. Therefore, I need a freelancer who is proficient in both .Net and Maui and can confidently complete the application. Ideal skills and experience: - Proficiency in .Net and Maui - Experience in mobile application development - Understanding of user interface intera...

    €161 (Avg Bid)
    €161 Oferta mesatare
    17 ofertat

    ...performance improvements. - Regular software updates and security patches. - Feature additions and enhancements. Skills and Experience: - Proven experience in maintaining e-commerce solutions. - Proficiency in React, Node.js, Python, and MySQL. - Strong problem-solving skills. - Excellent understanding of software best practices and design patterns. - Ability to work independently and meet deadlines. - .NET and are a plus but not a requirement. Prerequisites: For the long term project the *STARTING* wage will be as stated below. 1) Accept initial hourly rate of U$5.00 2) If awarded, accept and start work IMMEDIATELY 3) Have MINIMUM OF 20+ hours a week for long term ongoing support and development. 4) Work hours: predominantly 20:00 to 02:00 (UTC -3 Brazil TIME) 5) Be availabl...

    €6 / hr (Avg Bid)
    €6 / hr Oferta mesatare
    34 ofertat

    I am in search of a skilled .NET Core developer to work on a project for me. As the client, I'm looking for someone who can bring the following to the table: - Proficiency in .NET Core: Given that my project is based on this technology, familiarity and experience with it is a must. - Application Development Experience: Previous experience in developing web applications would be particularly beneficial. - Strong Problem-Solving Skills: The ability to troubleshoot issues and devise solutions is key. - Attention to Detail: It's important that our project is implemented correctly and accurately. The ideal candidate for this project would be someone who understands the nuances of .NET Core, has a good track record in application development, and can work efficie...

    €30 (Avg Bid)
    €30 Oferta mesatare
    1 ofertat
    Website Consolidation Specialist 6 ditë left
    VERIFIKUAR

    I have two websites that need to be merged with a main focus on consolidating information. The current websites are different in des...Strong organizational and prioritization skills - Ability to understand and implement user-centric content organization - SEO's also need to link seamlessly Please let me know your experience with similar projects and your approach to this particular task. Your input on the best ways to consolidate the information and prioritize content is highly appreciated. Website language is: - Linux AMI > OS - PHP > web and back-end - NodeJS > ICS - > ICS & Warehouse App - Ionic v1 > Warehouse App - Apache > web server - Database: MySQL Aurora - AWS hosted, leveraging EC2, RDS and S3 - Front-end is custom framework mix of ...

    €3673 (Avg Bid)
    €3673 Oferta mesatare
    61 ofertat
    Industrial Product Expert Needed 6 ditë left
    VERIFIKUAR

    I currently need an experienced industrial designer who can help me perfect a textile net for my product designed for basketball practice. Online, the main task will be to take the prototype of my existing product and make improvements through computing and then send it to be manufactured.

    €121 (Avg Bid)
    €121 Oferta mesatare
    31 ofertat

    Full Stack .NET Core Developer Needed to develop our whats app api platform A basic requirement is that he has previously worked on the WhatsApp API platform. I can review it before starting work

    €247 (Avg Bid)
    €247 Oferta mesatare
    29 ofertat

    ...1) Linux staging server setup -> deploy our existing project to a new VPS using gitlab 2) Woocommerce -> continue long term development work on our existing custom plugin. Transfer the existing production woocommerce to this staging server. 3) ongoing long term development of our CRM app Other components of our stack which are a HUGE ADDED BENEFIT if you can work on them -> .NET ASP, WEB API + MS SQL DETAILS HERE -> PRIORITY IS TO HAVE A DEVELOPER ON OUR TEAM (LONG TERM) THAT CAN FOR NOW ALSO WORK WEEKENDS AS WE HAVE SEVERAL EMERGENCIES TO FINISH URGENTLY. Someone who can efficiently manage Linux VPS and efficiently use GITLAB is critical. Initially we need part of the hours to be worked in the first weeks from 8:00PM- 2:00am UTC -3 (Brazil Time)

    €8 / hr (Avg Bid)
    €8 / hr Oferta mesatare
    25 ofertat

    ...AS WE HAVE SEVERAL EMERGENCIES TO FINISH URGENTLY. We will start with 5-10 small task in and then go to some smaller .NET tasks all with 1 day sprints for you to become familiar with the software and then our main goal will be to integrate another B2B API for our MVNO. Initially we need part of the hours to be worked in the first weeks from 8:00PM- 2:00am UTC -3 (Brazil Time) later you can work on your time zone. If you are awarded the task we expect you to accept IMMEDIATELY and if the project is not accepted immediatly we will award it to another developer. To qualify you must be full stack and work PROFICIENTLY with gitlab and code in ., .NET ASP, WEB API + MS SQL. We also have woocommerce and have developed and will continue to develop plugins, so PHP and unders...

    €7 / hr (Avg Bid)
    €7 / hr Oferta mesatare
    30 ofertat

    I'm looking for a skilled freelancer to develop a customized net worth spreadsheet. This spreadsheet should enable me to meticulously track my financial progress across various categories. Key Requirements: - The spreadsheet should allow me to input and monitor: - Investments (especially individual stocks) - Debt - Savings - Income - Expenses - Other category for miscellaneous expenses or income - I require a simple, user-friendly design that makes manual data entry easy and intuitive. Skills and Experience: - Proficiency in spreadsheet software such as Excel or Google Sheets is essential. - Experience in financial tracking and net worth management is highly beneficial. - Understanding of stock market, investment tracking, and basic accounting principle...

    €56 (Avg Bid)
    €56 Oferta mesatare
    16 ofertat

    Hello, I have my Python/Django site hosted on PythonAnywhere and it's facing a NET::ERR_CERT_DATE_INVALID issue. Website : I would appreciate someone help to troubleshoot this issue and fix the NET::ERR_CERT_DATE_INVALID error, ensuring that the SSL/TLS certificate is correctly set up. - Website troubleshooting and error resolution - SSL/TLS certificate configuration. Thanks in advance !

    €12 / hr (Avg Bid)
    €12 / hr Oferta mesatare
    21 ofertat

    I'm seeking an experienced DevOps engineer who is proficient in deploying React Frontend and .NET Core 8 applications to Alma Linux with NGinx server. The candidate should have solid experience with: - Deploying React FrontEnd and .NET Core 8 Web API applications on Alma Linux in GoDaddy VPS. - Knowledge of routing of both applications with one domain and one SSL. - Knowledge of handling SubDomain. - Knowledge of Alma Linux Nginx deployment. - Understanding of .NET Core Application Settings and React.JS application settings - Understanding of Node.JS

    €52 (Avg Bid)
    €52 Oferta mesatare
    13 ofertat

    I need a skilled .Net MAUI developer to assist me with my existing project. The main tasks for this project include: - Fixing bugs: The project is currently experiencing some issues which are negatively affecting the user experience. The specific bugs are not provided in this brief, but I can share details during our discussion. - App Publishing: Once the bugs are resolved, you will be responsible for publishing the updated version of the app to both Android and iOS stores. - Delivery of the final source code and making sure it is running on our machine. The ideal freelancer for this project should: - Have a proven track record in debugging and resolving issues in .Net MAUI projects. - Be proficient in the publishing process for both Android and iOS stores and should b...

    €180 (Avg Bid)
    €180 Oferta mesatare
    39 ofertat

    ...each agent individually: - Other agents cannot see each other's campaigns. 4. Ability for the main agent to assign one campaign to all of their agents. 5. Exporting statistics by agents: - Export a text (or any other) file with answered/unanswered numbers specifically for that agent. - Export statistics for a specific campaign or overall for the day. 6. Integration with Magnus Billing based on Asterisk 13: - Login credentials for the auto-dialing module correspond to Magnus Billing users. 7. It will be web-based. 8. Easy connection to another Magnus Billing server and transferring the module to another server. 9. Ability to manage AutoDialer users Create a new user, delete an old one, disable a user Please provide a brief overview of your relevant experience and how you...

    €2547 (Avg Bid)
    €2547 Oferta mesatare
    65 ofertat

    Ideal Skills and Experience: - Proficient in C# programming language and .NET framework - Experience in developing desktop applications - Familiarity with Visual Studio - Ability to implement data encryption and database integration - Expertise in developing secure user authentication mechanisms Please provide relevant examples of your previous work in C# desktop application development.

    €6 / hr (Avg Bid)
    €6 / hr Oferta mesatare
    24 ofertat

    I need a professional website that aptly portrays my investment advisory services and showcases my portfolio. The website should cater to individual investors, small business owners, and high-net-worth individuals. Key Features: - Detailed and clear information about my advisory services: Candidates with experience in creating informative and engaging content relating to finance or investments will have an advantage. - An investment portfolio section: The ideal freelancer should demonstrate an ability to elegantly display financial data in an accessible manner. - A contact form: Allow visitors to submit inquiries directly through the site. - An investment calculator: This needs to be user-friendly and visually appealing, requiring both frontend and backend capabilities. Ideal...

    €125 (Avg Bid)
    €125 Oferta mesatare
    21 ofertat

    ...accessories field. If you have the creativity and skills to bring fresh ideas and elegant solutions, please send us your portfolio. Let’s create something amazing together! This project involves Arabic-inspired products. Based in Kuwait ?? Thanks Plz read carefully before replying , your 1st understanding of the project will effect my decision..! Attached suggested logo and some references from the net .. regards...

    €194 (Avg Bid)
    €194 Oferta mesatare
    125 ofertat

    I'm l...outreach, and connections to identify suitable candidates. - Running Portfolios: Coordinate the portfolios of these individuals, tracking their performance and making strategic adjustments as needed. - Generating Portfolios via Events: Plan and execute events that attract potential club presidents and generate new portfolios. The ideal candidate should have: - Proven experience in sourcing high-net-worth individuals - An existing network in the business and finance world - Strong project management skills, especially in portfolio management - Excellent communication and negotiation skills This project will be handled collaboratively, so I'm looking for someone who can bring creativity and strategic vision to the table. Please provide details of your relevant expe...

    €18 - €154
    €18 - €154
    0 ofertat

    My project requires an experienced programmer who has the technical abilities to modify an XSL style sheet and adjust its layout. The task will specifically focus on: - Changing the layout of the style sheet and VB code. This modification is needed to appropriately accommodate some new fields that have been added to an import file. - Improving the style sheet so as to automatically map the new fields from the import file. The ideal candidate for this job should have experience with layout adjustments in XSL style sheets, automatic mapping of new fields and VB coding. Your skills and experience in rearranging content layout, updating fonts & colors, and altering data display formats will be highly appreciated. Don't hesitate to place your bid if you can deliver t...

    €129 (Avg Bid)
    Urgjent
    €129 Oferta mesatare
    26 ofertat

    I'm in need of an experienced web developer with strong shell scripting skills. While the main purpose of the website application is not specified, it's targeted at the general public. Ideal Skills and Experience: - Proven expertise in web application development - Experience in creating websites geared towards the general public - Robust skills in shell scripting - Ability to independently make decisions to enhance website functionalities Note: As the tasks for shell scripting are undefined, a flexible way of working is preferred for meeting emergent needs in the project.

    €25 (Avg Bid)
    €25 Oferta mesatare
    23 ofertat

    I have a frontend project built using React and Mobx. The main focus of this project is to clean up the code structure while enhancing the performance of the app. Understanding of .net would be a great plus. Key requirements: 1. **Code Structure Cleanup:** The existing code structure needs to be reorganized and optimized to ensure it's well-maintained and scalable in the future. 2. **Performance Improvement:** The main goal of this cleanup is to enhance the performance of the app. This might involve identifying and removing any redundant code, refactoring certain functions, or optimizing data flow. 3. **Coding Standards:** While there are no strict coding standards in place currently, I'm open to suggestions on implementing best practices. The chosen freelancer should b...

    €433 (Avg Bid)
    €433 Oferta mesatare
    124 ofertat

    I am looking for a proficient C# developer who can build a .Net 8 Console application with in-depth CSV handling capabilities. You will need to be able to: - Import CSV files; - Validate CSV data, specifically focusing on data format and range checks; - Convert validated CSV data to a c# DTO format; - Post the converted data to an API. Responding to errors is a significant part of the project. The application should be able to handle any issues encountered during the import, validation, or conversion processes seamlessly. Proficiency in C# is a core necessity, with previous experience in CSV handling and data validation highly desired.

    €141 (Avg Bid)
    Urgjent
    €141 Oferta mesatare
    36 ofertat

    I'm searching for a highly proficient .NET developer with a strong background in .NET Framework. The scope of this project involves: - Developing a multifaceted data management system for optimal organization and analysis - Creating a robust e-commerce system to drive online sales - Designing a custom application per specified functionality needs The ideal candidate should demonstrate an in-depth understanding of C#, with significant experience applying it within the realm of .NET Framework. Your portfolio should exhibit your versatility in leveraging the .NET Framework for a range of use-cases with a focus on data management, e-commerce solutions, and custom app development.

    €16 / hr (Avg Bid)
    €16 / hr Oferta mesatare
    11 ofertat

    ...award it to another developer. To qualify you must be full stack and conde in . , .NET ASP WEB API + MS SQL Details of our current project STACK can be seen here -> Prerequisites: For this optimization task you can bid your normal hourly rate but for the long term project the starting wage will be as stated below. 1) Accept initial hourly rate of U$5.00 2) Accept and start work immediatly 3) Have MINIMUM OF 20+ hours a week for long term ongoing support and development. 4) If you are awarded the project accept IMMEDIATELY 5) Work hours: predominantly 20:00 to 02:00 (UTC -3 Brazil TIME) 6) Be available to work on weekends. Our projects use: GITLAB -> , ag-grid, C#, .NET API, MS SQL 2017 , WooCommerce digital product sales This is for ongoing long term deve...

    €7 / hr (Avg Bid)
    €7 / hr Oferta mesatare
    48 ofertat

    I need an experienced Maui/Xamarin programmer who can write a native code helper to access(CRUD) the notes field of a selected contact in contacts/phonebook. Primarily for Android bu need to do same on iOS. Therefore programmer needs familiarity with within .net Maui project targetting Android iOs 1) Android code helper 'getnotes(contactid)', returning the notes field of the selected contact Id 'savenotes(contactid,newnote)', posts edited/new notes to notes field of contact Id 2) ditto for iOs Note Maui has an interface to both iOs and Android phoebook/contacts. It does not however offer access to Notes field - therefore this has to be done using native code. In Android my preference is to use a Contentresolver.

    €470 (Avg Bid)
    €470 Oferta mesatare
    37 ofertat

    .NET API to check for misconfiguration in AD CS.

    €460 (Avg Bid)
    €460 Oferta mesatare
    1 ofertat

    I'm seeking a skilled full stack developer to help with a web application project that I'm working on. The ideal candidate should be proficient in JavaScript and .NET, with specific experience in Angular and SQL Server. Key Skills and Experience: - Proficiency in JavaScript and .NET. - Strong knowledge of Angular and SQL Server. - Previous experience in developing web applications. - Ability to work collaboratively in a team setting. Responsibilities: - Develop the front-end using Angular. - Design and maintain the back-end of the application using .NET. - Ensure seamless integration of SQL Server for database management. - Conduct thorough testing to guarantee the application's functionality. This is a great opportunity for a skilled full stack devel...

    €895 (Avg Bid)
    €895 Oferta mesatare
    43 ofertat

    I need a .NET software developer to work on a project for me urgently. Key Responsibilities: - Your main task will be software development. I need a professional who can create efficient and high-quality software for my project. Skills & Experience: - Proficiency in ASP.NET, Entity Framework, and Windows Forms is crucial. - Prior experience with similar projects or a portfolio demonstrating your capability in software development would be a bonus. The project is time-sensitive, so I need it completed ASAP. If you're a .NET expert who can hit the ground running on software development, I'd love to hear from you.

    €177 (Avg Bid)
    €177 Oferta mesatare
    84 ofertat
    Dot Net sostware update 4 ditë left
    VERIFIKUAR

    I am currently facing a fairly serious issue with my dot net software - it crashes habitually, specifically when performing a certain function or operation. This has proven to be a major nuisance and has hampered my tasks significantly. Key Objectives: - Discover the root cause of the crashes - Implement a robust and permanent solution to prevent future crashes This project calls for a seasoned dot net developer who has extensive experience with troubleshooting and issue-resolution. Having a strong background in software maintenance and optimization is a definite plus. The ideal candidate will possess: - Experience fixing crash issues with dot net software - Ability to work methodically to identify the source of the issue - Exceptional problem-solving capability ...

    €64 (Avg Bid)
    €64 Oferta mesatare
    5 ofertat
    Intermediate .NET Trainer Required 4 ditë left
    VERIFIKUAR

    I’m looking for an individual with a strong intermediate knowledge level of .NET to conduct training for a small group of 1 to 10 people. Here are the key details about the training to be conducted: - This role requires someone experienced with .NET Core and ASP.NET. Your primary focus will be these areas and you should be able to deliver training effectively on this. - As a trainer, you would need to have an excellent command of these concepts and the ability to explain them in a way that's easy for the participants to understand. - Previous experience with delivering .NET training is a significant plus. 1 day physially training for MIS level audience. location at Bandar Sri Damansara.

    €121 (Avg Bid)
    €121 Oferta mesatare
    15 ofertat

    necesito una app ya sea en VB code o inventor que lea en tiempo real 3 sensores calor corporal, ritmo cardiaco y estres, se necesita lo mas rapido posible.

    €28 (Avg Bid)
    €28 Oferta mesatare
    1 ofertat

    necesito una app ya sea en VB code o inventor que lea en tiempo real 3 sensores calor corporal, ritmo cardiaco y estres, se necesita lo mas rapido posible.

    €399 (Avg Bid)
    €399 Oferta mesatare
    13 ofertat

    ...developer who can work with Visual Basic and/or .NET to create an application with the following requirements: Backend Functionality: - User Authentication: Develop a secure and efficient user authentication system. - Database Integration: Implement a database management system to store and retrieve data. - API Integration: Integrate external APIs to enhance the application’s functionality. Frontend Development: - Develop an intuitive and user-friendly interface for the application. - Ensure that the frontend interacts seamlessly with the backend. Deployment: - Once the development work is complete, you will be responsible for uploading the application to the server of our choice. Ideal Skills and Experience: - Proficiency in Visual Basic and/or .NET - Experience...

    €1013 (Avg Bid)
    €1013 Oferta mesatare
    115 ofertat

    I'm looking for a UI designer to create a user experience that's specifically tailored for high net worth individuals. The project involves designing for both mobile (iOS, Android) and web platforms. Key Project Points: **Enhancing User Experience:** The primary goal of this project is to make navigation and interaction as intuitive and user-friendly as possible for such HNIs. **Multi-Platform Design:** The user interface should be consistent and optimized for both mobile (iOS, Android) and web platforms. Experience in responsive design is a must. For the phase 1, below are the requirements: $$ The application caters to investors / high net worth individuals, who want to invest in startups. Below 3 screens are expected: 1. On the homepage, there will be li...

    €68 (Avg Bid)
    I garantuar
    €68
    13 kandidaturat

    I'm in need of a skilled .Net 8.0 expert to help me fix a Google OAuth issue. The issue lies in the fact that I cannot authenticate users through Google's OAuth system. The primary purpose of this application is user authentication. Ideal candidate for the task should have the following skills and experience: - Proficiency in .NET 8.0 - Extensive experience working with Google OAuth - Strong problem-solving skills - A focus on clean code and system performance - An understanding of user authentication systems. Candidate must have experience with ServiceStack. Please explain what service stack is in the application. Issue needs to be sorted in 48 hours.

    €170 (Avg Bid)
    €170 Oferta mesatare
    23 ofertat

    Sistema de gestión odontológica que tiene módulos de Login y seguridad, gestión de roles y permisos, ingreso de pacientes, ingreso de doctores, ingreso de servicios radiográficos, pagos de los servicios, reportes y gestión de los servicios radiográficos, se debe realizar en Net 6 u 8, Angular, Postgresql

    €11 / hr (Avg Bid)
    €11 / hr Oferta mesatare
    11 ofertat

    I need a professional IT specialist resume writer. This resume will need to highlight my expertise as a FrontEnd webdevelopment proficient in Angular and .net. Key points: - You will need to have experience in IT resume writing. - The resume should focus on my skills as a FrontEnd webdevelopment. - Proficiency in Angular and .net should be highlighted. - The resume should get more than 95 score on jobscan. Skills Required

    €17 (Avg Bid)
    €17 Oferta mesatare
    15 ofertat
    IT Resume Writer. 3 ditë left

    I need a professional IT specialist resume writer. This resume will need to highlight my expertise as a Full Stack Developer proficient in Angular and .net. Key points: - You will need to have experience in IT resume writing. - The resume should focus on my skills as a Full Stack Developer. - Proficiency in Angular and .net should be highlighted. - The resume should get more than 95 score on jobscan.

    €44 (Avg Bid)
    €44 Oferta mesatare
    33 ofertat

    We are the largest and fastest growing UK charity community delivering support through multiple services via our website. Our website and AI machine learning and GPT are handled by others. We need dev support for the core SQL system and 2 small SQL directories, plus running reports and system admin. We need full stack Microsoft .NET development experience, strong SQL knowledge and exposure to Azure Microsoft services. We require a range of services. We’ll begin with the ad hoc work to begin to build a working relationship and then build that up to the following on an ongoing basis. • Ad hoc tasks for minor tweaks and changes on an ongoing basis. • Larger pieces of work, such as creating a moving from a free to a free and premium versions, with upgrading our He...

    €16 / hr (Avg Bid)
    €16 / hr Oferta mesatare
    64 ofertat

    I'm in need of a talented Keycloak software developer with a solid grasp of .NET. The primary goal of this project will be to develop a custom user management and authorization system. Key Responsibilities: - Create a custom user management and authorization system using Keycloak - Implement role-based access control - Develop user registration and profile management features - Integrate the solution with our existing user database The ideal candidate for this project would have: - Proficiency in Keycloak - Extensive experience with .NET - A strong understanding of user management systems and implementing role-based access control - Previous experience integrating user databases List of views: - Login - Users - App roles - User groups Development for User Management...

    €471 (Avg Bid)
    €471 Oferta mesatare
    40 ofertat

    ...Services for NLP and machine learning Additional Features * Support for multiple languages and locales * Customizable user interface and branding * Integration with other Microsoft tools and services (e.g., Office, Azure) * Security and compliance features (e.g., encryption, access controls) On-Prem Client: * Quivr Agent * Programming Language: C# or C++ * Framework: Windows Desktop (.NET Framework or .NET Core) or macOS (Xamarin or macOS SDK) * Database: Azure Storage or Microsoft SQL Server (local instance) * File System: Windows File System or macOS File System * Networking: HTTPS (TLS 1.2 or later) * Installation: Windows Installer (MSI) or macOS Installer (PKG) * GitHub Solution: * Local Data Storage * Azure Storage (Blob Storage or F...

    €537 (Avg Bid)
    €537 Oferta mesatare
    26 ofertat

    ...this, I am seeking a highly skilled professional to help me reinstall the system and rectify all the problems at hand. The job involves the following steps: 1) Change the OS from Linux to Windows Server 2016 or Higher (This may cause the data to be erased. In this case use the copy of the site and reinstall 2) Download Windows Server 2016 II, Office 2019, , .NET Framework 4.7 or 4.8, Visual FoxPro 9 Executable. And it should be Configured to the present environment. 3) In the first menu of , there is a function “Chemplan Online”. Chemplan database and EXE are residing at the server, this should be connected to the online function discussed above . 4) Chemplan and all its functionality should be tested and should

    €125 (Avg Bid)
    €125 Oferta mesatare
    18 ofertat

    I am looking for an individual or a business with a strong network of high net worth individuals and/or family offices that would be willing to introduce me to and help me pitch to them an Accountancy Practice Roll-Up project I am running and requires funding. I am looking to raise £500,000 in equity in rounds 1 and 2, within 3-9 months time. The payment will be as a percentage of the funds raised successfully for the project through this person or company. It will have to be equity participation. Loans are not considered at this stage. - Strong Network: Leveraging your connections to high net worth individuals is crucial. I need to tap into your relationships to pitch my business concept. - Industry Experience: Having a background in raising funds for roll ups, s...

    €17906 (Avg Bid)
    I cilësuar MRS
    €17906 Oferta mesatare
    6 ofertat
    Ordering and invoicing system 2 ditë left
    VERIFIKUAR

    ...hosted by a web host. Our customers send orders electronically in EDIFACT format. These orders contain an order number, different delivery points, each of which has its own GLN (customer number), different items and the quantities of the items. There must be a way for the operator to independently create items that can be ordered. These items always have an EAN number, a product name and a net price. Net price is the price without VAT. The orders should appear in a list. When our employee calls up this list, he can see these complete orders and then decide whether he wants to process individual orders or all of them together. This should be done using a checkbox. Click on checkboxes for individual orders and if you click on a checkbox, all checkboxes for all orders wi...

    €2514 (Avg Bid)
    €2514 Oferta mesatare
    43 ofertat
    API Developer 2 ditë left

    ...high-performance APIs and programs using C#, .NET Core based on architecture frameworks and guidelines Prepare API Collection and Documentation Collaborate with external and internal teams to test and troubleshoot performance and functional issues Work towards DevOps model for continuous integration (CI) and continuous delivery/deployment (CD) pipelines Technical Skills: API developers should have comprehensive technical skills, including the following: Ability to work on protocols like HTTP, FTP and Web Sockets Ability to create APIs using REST pattern Knowledge of GraphQL and gRPC is an added advantage Knowledge of Web Services and understanding of service-oriented architecture (SOA) Proficiency with common API development frameworks/tools, including .NET Core 6+, MS ...

    €327 (Avg Bid)
    €327 Oferta mesatare
    36 ofertat

    ...bringing to mind an image of dependability and expertise in wealth management Domain name availability: ".com" Domain should be available Ideal Skills and Experience of branding person: - Expertise in marketing and branding - Familiar with wealth management industry - Background in finance or related fields Responsibilities: - Create a brand name for Mobile Application that appeals to high net worth individuals - It must be original and memorable - The name should be short and should be easy to remember - It should reflect positivity and no negativity Industry: Financial planning, Wealth management, Investments, Insurance, Retirement, etc. Ultimately, I am aiming for a brand name that effectively reaches the sophisticated audience, and encapsulates the high lev...

    €77 (Avg Bid)
    I garantuar
    €77
    131 kandidaturat