Asterisk vb net punët
Pershendetje Ardit, keni eksperience me Suite crm apo Vtiger crm? kam nevoje pernje konfigurim ne lidhje me crm dhe asterisk
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
My project requires an experienced programmer who has the technical abilities to modify an XSL style sheet and adjust its layout. The task will specifically focus on: - Changing the layout of the style sheet and VB code. This modification is needed to appropriately accommodate some new fields that have been added to an import file. - Improving the style sheet so as to automatically map the new fields from the import file. The ideal candidate for this job should have experience with layout adjustments in XSL style sheets, automatic mapping of new fields and VB coding. Your skills and experience in rearranging content layout, updating fonts & colors, and altering data display formats will be highly appreciated. Don't hesitate to place your bid if you can deliver t...
I'm in need of an experienced web developer with strong shell scripting skills. While the main purpose of the website application is not specified, it's targeted at the general public. Ideal Skills and Experience: - Proven expertise in web application development - Experience in creating websites geared towards the general public - Robust skills in shell scripting - Ability to independently make decisions to enhance website functionalities Note: As the tasks for shell scripting are undefined, a flexible way of working is preferred for meeting emergent needs in the project.
I have a frontend project built using React and Mobx. The main focus of this project is to clean up the code structure while enhancing the performance of the app. Understanding of .net would be a great plus. Key requirements: 1. **Code Structure Cleanup:** The existing code structure needs to be reorganized and optimized to ensure it's well-maintained and scalable in the future. 2. **Performance Improvement:** The main goal of this cleanup is to enhance the performance of the app. This might involve identifying and removing any redundant code, refactoring certain functions, or optimizing data flow. 3. **Coding Standards:** While there are no strict coding standards in place currently, I'm open to suggestions on implementing best practices. The chosen freelancer should b...
I am looking for a proficient C# developer who can build a .Net 8 Console application with in-depth CSV handling capabilities. You will need to be able to: - Import CSV files; - Validate CSV data, specifically focusing on data format and range checks; - Convert validated CSV data to a c# DTO format; - Post the converted data to an API. Responding to errors is a significant part of the project. The application should be able to handle any issues encountered during the import, validation, or conversion processes seamlessly. Proficiency in C# is a core necessity, with previous experience in CSV handling and data validation highly desired.
I'm searching for a highly proficient .NET developer with a strong background in .NET Framework. The scope of this project involves: - Developing a multifaceted data management system for optimal organization and analysis - Creating a robust e-commerce system to drive online sales - Designing a custom application per specified functionality needs The ideal candidate should demonstrate an in-depth understanding of C#, with significant experience applying it within the realm of .NET Framework. Your portfolio should exhibit your versatility in leveraging the .NET Framework for a range of use-cases with a focus on data management, e-commerce solutions, and custom app development.
...award it to another developer. To qualify you must be full stack and conde in . , .NET ASP WEB API + MS SQL Details of our current project STACK can be seen here -> Prerequisites: For this optimization task you can bid your normal hourly rate but for the long term project the starting wage will be as stated below. 1) Accept initial hourly rate of U$5.00 2) Accept and start work immediatly 3) Have MINIMUM OF 20+ hours a week for long term ongoing support and development. 4) If you are awarded the project accept IMMEDIATELY 5) Work hours: predominantly 20:00 to 02:00 (UTC -3 Brazil TIME) 6) Be available to work on weekends. Our projects use: GITLAB -> , ag-grid, C#, .NET API, MS SQL 2017 , WooCommerce digital product sales This is for ongoing long term deve...
I need an experienced Maui/Xamarin programmer who can write a native code helper to access(CRUD) the notes field of a selected contact in contacts/phonebook. Primarily for Android bu need to do same on iOS. Therefore programmer needs familiarity with within .net Maui project targetting Android iOs 1) Android code helper 'getnotes(contactid)', returning the notes field of the selected contact Id 'savenotes(contactid,newnote)', posts edited/new notes to notes field of contact Id 2) ditto for iOs Note Maui has an interface to both iOs and Android phoebook/contacts. It does not however offer access to Notes field - therefore this has to be done using native code. In Android my preference is to use a Contentresolver.
.NET API to check for misconfiguration in AD CS.
I'm seeking a skilled full stack developer to help with a web application project that I'm working on. The ideal candidate should be proficient in JavaScript and .NET, with specific experience in Angular and SQL Server. Key Skills and Experience: - Proficiency in JavaScript and .NET. - Strong knowledge of Angular and SQL Server. - Previous experience in developing web applications. - Ability to work collaboratively in a team setting. Responsibilities: - Develop the front-end using Angular. - Design and maintain the back-end of the application using .NET. - Ensure seamless integration of SQL Server for database management. - Conduct thorough testing to guarantee the application's functionality. This is a great opportunity for a skilled full stack devel...
I need a .NET software developer to work on a project for me urgently. Key Responsibilities: - Your main task will be software development. I need a professional who can create efficient and high-quality software for my project. Skills & Experience: - Proficiency in ASP.NET, Entity Framework, and Windows Forms is crucial. - Prior experience with similar projects or a portfolio demonstrating your capability in software development would be a bonus. The project is time-sensitive, so I need it completed ASAP. If you're a .NET expert who can hit the ground running on software development, I'd love to hear from you.
I am currently facing a fairly serious issue with my dot net software - it crashes habitually, specifically when performing a certain function or operation. This has proven to be a major nuisance and has hampered my tasks significantly. Key Objectives: - Discover the root cause of the crashes - Implement a robust and permanent solution to prevent future crashes This project calls for a seasoned dot net developer who has extensive experience with troubleshooting and issue-resolution. Having a strong background in software maintenance and optimization is a definite plus. The ideal candidate will possess: - Experience fixing crash issues with dot net software - Ability to work methodically to identify the source of the issue - Exceptional problem-solving capability ...
I’m looking for an individual with a strong intermediate knowledge level of .NET to conduct training for a small group of 1 to 10 people. Here are the key details about the training to be conducted: - This role requires someone experienced with .NET Core and ASP.NET. Your primary focus will be these areas and you should be able to deliver training effectively on this. - As a trainer, you would need to have an excellent command of these concepts and the ability to explain them in a way that's easy for the participants to understand. - Previous experience with delivering .NET training is a significant plus. 1 day physially training for MIS level audience. location at Bandar Sri Damansara.
necesito una app ya sea en VB code o inventor que lea en tiempo real 3 sensores calor corporal, ritmo cardiaco y estres, se necesita lo mas rapido posible.
necesito una app ya sea en VB code o inventor que lea en tiempo real 3 sensores calor corporal, ritmo cardiaco y estres, se necesita lo mas rapido posible.
...developer who can work with Visual Basic and/or .NET to create an application with the following requirements: Backend Functionality: - User Authentication: Develop a secure and efficient user authentication system. - Database Integration: Implement a database management system to store and retrieve data. - API Integration: Integrate external APIs to enhance the application’s functionality. Frontend Development: - Develop an intuitive and user-friendly interface for the application. - Ensure that the frontend interacts seamlessly with the backend. Deployment: - Once the development work is complete, you will be responsible for uploading the application to the server of our choice. Ideal Skills and Experience: - Proficiency in Visual Basic and/or .NET - Experience...
I'm looking for a UI designer to create a user experience that's specifically tailored for high net worth individuals. The project involves designing for both mobile (iOS, Android) and web platforms. Key Project Points: **Enhancing User Experience:** The primary goal of this project is to make navigation and interaction as intuitive and user-friendly as possible for such HNIs. **Multi-Platform Design:** The user interface should be consistent and optimized for both mobile (iOS, Android) and web platforms. Experience in responsive design is a must. For the phase 1, below are the requirements: $$ The application caters to investors / high net worth individuals, who want to invest in startups. Below 3 screens are expected: 1. On the homepage, there will be li...
I'm in need of a skilled .Net 8.0 expert to help me fix a Google OAuth issue. The issue lies in the fact that I cannot authenticate users through Google's OAuth system. The primary purpose of this application is user authentication. Ideal candidate for the task should have the following skills and experience: - Proficiency in .NET 8.0 - Extensive experience working with Google OAuth - Strong problem-solving skills - A focus on clean code and system performance - An understanding of user authentication systems. Candidate must have experience with ServiceStack. Please explain what service stack is in the application. Issue needs to be sorted in 48 hours.
Sistema de gestión odontológica que tiene módulos de Login y seguridad, gestión de roles y permisos, ingreso de pacientes, ingreso de doctores, ingreso de servicios radiográficos, pagos de los servicios, reportes y gestión de los servicios radiográficos, se debe realizar en Net 6 u 8, Angular, Postgresql
I need a professional IT specialist resume writer. This resume will need to highlight my expertise as a FrontEnd webdevelopment proficient in Angular and .net. Key points: - You will need to have experience in IT resume writing. - The resume should focus on my skills as a FrontEnd webdevelopment. - Proficiency in Angular and .net should be highlighted. - The resume should get more than 95 score on jobscan. Skills Required
I need a professional IT specialist resume writer. This resume will need to highlight my expertise as a Full Stack Developer proficient in Angular and .net. Key points: - You will need to have experience in IT resume writing. - The resume should focus on my skills as a Full Stack Developer. - Proficiency in Angular and .net should be highlighted. - The resume should get more than 95 score on jobscan.
We are the largest and fastest growing UK charity community delivering support through multiple services via our website. Our website and AI machine learning and GPT are handled by others. We need dev support for the core SQL system and 2 small SQL directories, plus running reports and system admin. We need full stack Microsoft .NET development experience, strong SQL knowledge and exposure to Azure Microsoft services. We require a range of services. We’ll begin with the ad hoc work to begin to build a working relationship and then build that up to the following on an ongoing basis. • Ad hoc tasks for minor tweaks and changes on an ongoing basis. • Larger pieces of work, such as creating a moving from a free to a free and premium versions, with upgrading our He...
I'm in need of a talented Keycloak software developer with a solid grasp of .NET. The primary goal of this project will be to develop a custom user management and authorization system. Key Responsibilities: - Create a custom user management and authorization system using Keycloak - Implement role-based access control - Develop user registration and profile management features - Integrate the solution with our existing user database The ideal candidate for this project would have: - Proficiency in Keycloak - Extensive experience with .NET - A strong understanding of user management systems and implementing role-based access control - Previous experience integrating user databases List of views: - Login - Users - App roles - User groups Development for User Management...
...Services for NLP and machine learning Additional Features * Support for multiple languages and locales * Customizable user interface and branding * Integration with other Microsoft tools and services (e.g., Office, Azure) * Security and compliance features (e.g., encryption, access controls) On-Prem Client: * Quivr Agent * Programming Language: C# or C++ * Framework: Windows Desktop (.NET Framework or .NET Core) or macOS (Xamarin or macOS SDK) * Database: Azure Storage or Microsoft SQL Server (local instance) * File System: Windows File System or macOS File System * Networking: HTTPS (TLS 1.2 or later) * Installation: Windows Installer (MSI) or macOS Installer (PKG) * GitHub Solution: * Local Data Storage * Azure Storage (Blob Storage or F...
...this, I am seeking a highly skilled professional to help me reinstall the system and rectify all the problems at hand. The job involves the following steps: 1) Change the OS from Linux to Windows Server 2016 or Higher (This may cause the data to be erased. In this case use the copy of the site and reinstall 2) Download Windows Server 2016 II, Office 2019, , .NET Framework 4.7 or 4.8, Visual FoxPro 9 Executable. And it should be Configured to the present environment. 3) In the first menu of , there is a function “Chemplan Online”. Chemplan database and EXE are residing at the server, this should be connected to the online function discussed above . 4) Chemplan and all its functionality should be tested and should
I am looking for an individual or a business with a strong network of high net worth individuals and/or family offices that would be willing to introduce me to and help me pitch to them an Accountancy Practice Roll-Up project I am running and requires funding. I am looking to raise £500,000 in equity in rounds 1 and 2, within 3-9 months time. The payment will be as a percentage of the funds raised successfully for the project through this person or company. It will have to be equity participation. Loans are not considered at this stage. - Strong Network: Leveraging your connections to high net worth individuals is crucial. I need to tap into your relationships to pitch my business concept. - Industry Experience: Having a background in raising funds for roll ups, s...
...hosted by a web host. Our customers send orders electronically in EDIFACT format. These orders contain an order number, different delivery points, each of which has its own GLN (customer number), different items and the quantities of the items. There must be a way for the operator to independently create items that can be ordered. These items always have an EAN number, a product name and a net price. Net price is the price without VAT. The orders should appear in a list. When our employee calls up this list, he can see these complete orders and then decide whether he wants to process individual orders or all of them together. This should be done using a checkbox. Click on checkboxes for individual orders and if you click on a checkbox, all checkboxes for all orders wi...
...high-performance APIs and programs using C#, .NET Core based on architecture frameworks and guidelines Prepare API Collection and Documentation Collaborate with external and internal teams to test and troubleshoot performance and functional issues Work towards DevOps model for continuous integration (CI) and continuous delivery/deployment (CD) pipelines Technical Skills: API developers should have comprehensive technical skills, including the following: Ability to work on protocols like HTTP, FTP and Web Sockets Ability to create APIs using REST pattern Knowledge of GraphQL and gRPC is an added advantage Knowledge of Web Services and understanding of service-oriented architecture (SOA) Proficiency with common API development frameworks/tools, including .NET Core 6+, MS ...
...bringing to mind an image of dependability and expertise in wealth management Domain name availability: ".com" Domain should be available Ideal Skills and Experience of branding person: - Expertise in marketing and branding - Familiar with wealth management industry - Background in finance or related fields Responsibilities: - Create a brand name for Mobile Application that appeals to high net worth individuals - It must be original and memorable - The name should be short and should be easy to remember - It should reflect positivity and no negativity Industry: Financial planning, Wealth management, Investments, Insurance, Retirement, etc. Ultimately, I am aiming for a brand name that effectively reaches the sophisticated audience, and encapsulates the high lev...
...seasoned marketing professional to assist in boosting the visibility of my share market services. The deliverables I'm expecting are: - Strategic Online Advertising: Implementation of targeted online advertising campaigns to attract potential investors from across the board. - Social Media Engagement: Proven expertise in managing and growing social media platforms to engage with retail investors, high-net-worth individuals, and institutional investors. - Door Step Marketing: Develop and execute a door step marketing strategy to further promote my services at a personal level. The main objective of this project is to increase brand and market awareness, which means that you should be well-versed in creating and executing comprehensive marketing plans. Ideal candidates shou...
...As we fire up our grills and make vegetable salads for our summer barbecues, we know that we can safely consume cured meats and veggies as long as we maintain moderation. The preservatives, both natural and synthetic, help keep our foods safe from harmful pathogens so we can enjoy our meals without worry. The food label will state that there are “no nitrates or nitrites added,” but an asterisk will often lead to a fine-print addendum with the clarification, “except those naturally occurring in celery juice powder,” sea salt or a vegetable juice. As a result some “natural” or “organic” roast beef and turkey breast, or other products cured with sea salt, evaporated cane juice, potato starch, or natural flavorings or seasoning...
Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.
Needs to hire 2 Freelancers Warning: No TIME WASTERS. Only working directly with Developers only No third parties or Sales Guy or CEO prohibited on this project: will be reported n case of violence: most of the bidders are just time wasters so please make sure you are not one of them Dum persons. thanks we are looking Expert in Vue JS - Front End - Web API .Net core and good knowledge of handling web of Vue.js 2 and Vue.js expert level experience this gonna be a long term project for a right and skilled dev we are looking, so no time wasters please bid only if you are skilled full because technical screening will be done before hiring over here. we have project just started and right candidate expectation is to grasp and get going on it we are easy going company and only required ...
I am in need of a simple, yet powerful tool that will enable me to capture and analyze the IVR menu options of my clients' toll free numbers. This tool will serve the ...Currently one of my team member is dialing the client's phone number, listening to the IVR options and manually capturing the details as follows *Level 1* Press 1 for English Press 2 for Tamil Press 3 for Hindi *Level 2* Press 1 if you are an existing client Press 2 if you are calling us for the first time *Level 3* Press 1 for sales Press 2 for Accounts Press 3 for service We already have a asterisk dialler in place and have the capability to dial phone numbers and also record the conversation but we don't have the ability to listen to the IVR options, dial each option to drill down to each ...
I am currently valiantly battling with a multitude of issues with my .NET Core API, and I require the help of a seasoned professional. In need of someone who is proficient at: - Troubleshooting and fixing authentication errors: I am routinely encountering authentication issues which is deeply affecting usability. - Enhancing data consistency: I have been observing a distressing amount of data inconsistencies that need rectifying. - Implementing user registration and authentication: I need to provide my users with a smooth registration and login process to enhance platform accessibility. - Building data validation and error handling mechanisms: My API is in dire need of solid data validation and error handling procedures to increase reliability. - Integrating with external systems: ...
I'm seeking a highly skilled fullstack developer who is proficient in PHP, .NET, and especially SQL for diverse web application projects. Your primary role will be equal focus on both front-end and back-end development on multiple platforms, including WordPress and PHP. Mandated Features: * Database Integration - Structuring, optimizing, and ensuring smooth functioning of databases within applications. * API Integration - Implementing third-party APIs comprehensively. Ideal Skills and Experience: * Proficient in PHP, .NET, and SQL. * Strong experience with WordPress. * Proven full-stack capabilities. * Expertise in Database and API integration. * Good problem-solving abilities and attention to detail. We're expecting high quality work with minimal supervision....
...profit target and then trade 1 lot on LTCUSD to pass minimum days, this is not okay as LTC has a contract size of 1 while EURUSD has a contract size of 100,000. In this example, a 100 pip increase in LTCUSD would be equivalent to $10 but a 100 pip increase in EURUSD would be equivalent to $1,000. – Example 4: If you have 5 trades of EURUSD opened at the same time, each with a lot size of 1, your net position size is 5 Lots. Thus, if your smallest lot size is 0.5 lots, this is not okay. Taking advantage of the demo environment is also not permitted. Traders cannot trade digital currencies over the weekend to pass the minimum days." I traded 16 days to pass the challenge, and on 9 of those days at least I respected the rule. I am seeking legal assistance to...
I need a skilled network specialist to set up a single VPN tunnel between two routers using OpenVPN. The routers are both GL Net routers: the flint GL-AX1088 router and the GL - A1300-370 router. The main router on my server is the Lynksys Mesh router on a Gigaclear service provider. The main purpose of this VPN tunnel is to ensure secure data transfer between the two routers. in different countries. Key details: - The routers are using the DD-WRT operating system. Experience with this system is highly desirable. - Beyond the VPN tunnel, no additional security features need to be configured. Ideal skills for this job include: - Proficiency with OpenVPN and setting up secure VPN tunnels. - Experience in configuring routers, especially those running DD-WRT operating system. - ...
...focus on measuring investment performance, assessing risk and return, as well as tracking portfolio growth. Key Requirements: - Develop metrics for Return on Investment (ROI), Internal Rate of Return (IRR), Cash Multiple, and Net Asset Value (NAV). - Multiple on Invested Capital (MOIC Metric) - Gross Total Value to Paid in Capital (Gross TVPI Metric) - Net Total Value to Paid in Capital (net TVPI Metric) - Residula Value Per Paid In Capital (RVPI Metric) - Distributions per Paid In Capital (DPI Metric) - Gross IRR Metric - Gross Realized IRR Metric - Net IRR Metric - Net Realized IRR Metric - Revenue - Lifetime Value of a Customer (LTV) - Unit Economics - These metrics should be calculated on a quarterly basis. Ideal Candidate: - Experience in financ...
Hi Can you please design a logo of a welder pouring a hard solo into a HARD SOLO glass out of his welding gun with a VB can in a trash can. i would also like the caption "THE HOUSE POUR" in there too
I am looking for a talented and experienced social media manager to create and manage the social media profiles for our professional cycling team. Key Responsibilities: - Establishing and maintaining active and engaging profiles on Facebook, Instagram, Twitter, TikTok, and Snapchat. - Creating and sharing engaging content across the platform...and Snapchat. - Excellent written and verbal communication skills. - Ability to create engaging and shareable content. - Familiarity with the cycling industry and its audience. Your main objective would be to cultivate a strong online presence for our team, engaging with our target audience which includes cycling enthusiasts, sports fans, the general public, government leaders, celebrities, high net-worth individuals, and international medi...
I'm seeking an expert in .NET framework for a project that involves setting up a multi-tenant database. My preference is to have a separate database for each tenant, with the databases themselves being simple and containing only a few tables. Key Responsibilities: - Develop a multi-tenant functionality in .NET entity framework - Implement a separate database for each tenant - Design a simple database with few tables Ideal Skills & Experience: - Extensive experience in .NET Framework - Proven expertise in multi-tenant database setup - Proficiency in designing simple databases
Merhabalar. Kıbrıs'ta yaşıyorum. Daha önce canlı destek tecrübelerim oldu fakat bu bahis siteleri üzerine değildi. Yaptığım veya baştan öğrendiğim her işi hızlı bir şekilde öğrenme ve tam performanslı bir şekilde çalışabilen bir kişiyim. Laptop, telefon, hızlı internet, uzak masaüstü bilgisi, orta seviyede web tasarım bilgisi, photoshop vb. uygulamalarda tam bilgi vs. özelliklerim vardır. Tekliflerinizi bekliyorum!
I am seeking an experienced .Net developer who can proficiently build a web app with full focus on API endpoints creation. The web app should specifically support the creation of GET, POST, and PUT requests. Key Features: - Creation of API Endpoints - Support for GET, POST, and PUT requests. Ideal Skills: .NET Framework Web API Development REST API Integration Experience in database integration and user authentication would be a bonus, but the main requirement is expertise in .Net development and a solid understanding of the API lifecycle. The developer should be able to leverage modern .Net technologies and best practices to ensure efficient, secure, and scalable API integration.
As an experienced developer, my goal is to connect my existing trading BOT, already linked to Bitstamp, to Kraken API. The chosen candidate should be proficient in .NET, particularly .NET Core. Key Responsibilities: - Connect my BOT to the Kraken API using .NET Core - Implement functionalities for trade execution, market data analysis, and account management Ideal Skills: - Proficient in .NET, particularly .NET Core - Previous experience with API integration, preferably in the trading sector - Strong understanding of trade execution, market data analysis, and account management - Ability to troubleshoot and optimize the integration process for a seamless user experience. If you have the necessary skills and are confident in your ability to deliver th...
I'm in need of a unique plastic rectangular frame with a net for a beach game. The net will be used for a game similar to spikeball that will be played on the beach. It is similar to a a game called beer dye commonly played at colleges so I need to have 4 holes in each corner that can hold a ball similar to how poole is played where the balls fall in a hole Key requirements: - The frame should be durable, water-resistant and suitable for the beach environment. - The net should be of high quality and appropriate for game play. - The overall design should be innovative and engaging. The ideal freelancer for this project would have experience in: - Industrial design with an emphasis on sports equipment or outdoor products. - Fabrication of plastic product...