Asterisk cti vb punët

Pershendetje Ardit, keni eksperience me Suite crm apo Vtiger crm? kam nevoje pernje konfigurim ne lidhje me crm dhe asterisk

asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr

ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif

Merhabalar elimde PHP bir web sitesi mevcut bu siteden girilen Bilgileri android webvirew ile çekiyorum komlpe sayfayi örneğin Instagram profil resim vb gibi eklemeler yapınca geçerli uygulamaya yonlendirmiyir sadece Türkçe dilini bilen arkadaşlar irtibata gecsin

I'm in need of an experienced PBX / VOIP / SBC engineer who can address several issues with our customers phone systems system. The primary goal of this project is to troubleshoot and maintain current systems. Key Responsibilities: - Troubleshoot ongoing call quality issues - Investigate and resolve call drops - Address any connectivity problems Skills Required: - Extensive experience with Asterisk and other PBX systems - In-depth knowledge of VOIP network architecture - Proven track record in troubleshooting and maintenance Please only apply if you have a strong background in VOIP technologies and are confident in your ability to resolve issues.

Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.

I’m seeking a skilled developer to convert my existing PortVB Desktop App into an iOS/Mac Desktop App. It a small tool that runs on a Windows PC and reads some flat XML files and inserts/updates a mySQL database. We need the same program to be able run on a iOS/Mac desktop. I have all the VB Project files/ Source code. - Skills in app development for iOS/Mac, ideally with previous experience in app conversion - Knowledge of data syncing, user authentication, and offline access, in case these features need to be incorporated - Familiarity with contacts management, communication, scheduling, calendar integration, and file/document management functionalities for potential focus areas - Creative design skills to potentially revamp the user interface and overall design of t...

I'm in need of an Asterisk developer experienced with Asterisk 13. The primary task is to configure the system as a VoIP server for internal communication. Key requirements: - Understand Asterisk 13 well - Strong experience in setting up and configuring VoIP servers The ideal candidate should have: - Proven experience in customizing Asterisk for similar purposes - Good understanding of VoIP technologies and protocols - Ability to work independently and deliver high-quality work on time Please note that the project involves setting up the system, configuring call flows and ensuring it's ready for internal use.

I require an experienced and proficient developer who is familiar with both WebRTC and Asterisk. The objective is to expand the functionality of my current Asterisk setup by integrating it with WebRTC. The specific features to be integrated are: -Voice Calling -Video Conferencing This project seeks to enhance the communication capabilities of my Asterisk setup, thus the ideal candidate would have considerable experience managing such integrations in the past. Sound knowledge of VoIP, SIP, and related technologies will be greatly appreciated. An understanding of the Asterisk framework and its API will be critical.

I am in need of an expert who can effectively integrate WebRTC and Asterisk to achieve real-time audio and video communication. This functionality is intended primarily for internal team members. Therefore, it should ensure: - Seamless and effective call routing and handling - Successful integration with our existing telephony systems - Provision of standard-definition quality for both audio and video communication The ideal candidate for this project has substantial experience with WebRTC and Asterisk, and has successfully executed similar integration projects in the past. This professional should also be knowledgeable about telephony systems and their integration for real-time communication capabilities.

I require an individual proficient in VB macro script for Mach3. This project entails recreating a Mach4 script that particularly focuses on: - Arc motion control - Tool length calculation from spindle holder to tool tip - B/C axis management and position zeroing I have mach4 script that need to be rewriten to mach3 VB language, I have also a video how it works in mach4 fo refernece. You should be able to implement these specifications based on available documentation. Please remember that the recreated script should maintain as much fidelity to the original Mach4 script as possible. Ideal skills and experiences for the job include: - Familiarity with Mach3 and Mach4 CNC software - Expertise in creating VB macro scripts - Understanding of CNC machine operation, p...

...each agent individually: - Other agents cannot see each other's campaigns. 4. Ability for the main agent to assign one campaign to all of their agents. 5. Exporting statistics by agents: - Export a text (or any other) file with answered/unanswered numbers specifically for that agent. - Export statistics for a specific campaign or overall for the day. 6. Integration with Magnus Billing based on Asterisk 13: - Login credentials for the auto-dialing module correspond to Magnus Billing users. 7. It will be web-based. 8. Easy connection to another Magnus Billing server and transferring the module to another server. 9. Ability to manage AutoDialer users Create a new user, delete an old one, disable a user Please provide a brief overview of your relevant experience and how you...

My project requires an experienced programmer who has the technical abilities to modify an XSL style sheet and adjust its layout. The task will specifically focus on: - Changing the layout of the style sheet and VB code. This modification is needed to appropriately accommodate some new fields that have been added to an import file. - Improving the style sheet so as to automatically map the new fields from the import file. The ideal candidate for this job should have experience with layout adjustments in XSL style sheets, automatic mapping of new fields and VB coding. Your skills and experience in rearranging content layout, updating fonts & colors, and altering data display formats will be highly appreciated. Don't hesitate to place your bid if you can deliver t...

necesito una app ya sea en VB code o inventor que lea en tiempo real 3 sensores calor corporal, ritmo cardiaco y estres, se necesita lo mas rapido posible.

necesito una app ya sea en VB code o inventor que lea en tiempo real 3 sensores calor corporal, ritmo cardiaco y estres, se necesita lo mas rapido posible.

...As we fire up our grills and make vegetable salads for our summer barbecues, we know that we can safely consume cured meats and veggies as long as we maintain moderation. The preservatives, both natural and synthetic, help keep our foods safe from harmful pathogens so we can enjoy our meals without worry. The food label will state that there are “no nitrates or nitrites added,” but an asterisk will often lead to a fine-print addendum with the clarification, “except those naturally occurring in celery juice powder,” sea salt or a vegetable juice. As a result some “natural” or “organic” roast beef and turkey breast, or other products cured with sea salt, evaporated cane juice, potato starch, or natural flavorings or seasoning...

I am in need of a simple, yet powerful tool that will enable me to capture and analyze the IVR menu options of my clients' toll free numbers. This tool will serve the ...Currently one of my team member is dialing the client's phone number, listening to the IVR options and manually capturing the details as follows *Level 1* Press 1 for English Press 2 for Tamil Press 3 for Hindi *Level 2* Press 1 if you are an existing client Press 2 if you are calling us for the first time *Level 3* Press 1 for sales Press 2 for Accounts Press 3 for service We already have a asterisk dialler in place and have the capability to dial phone numbers and also record the conversation but we don't have the ability to listen to the IVR options, dial each option to drill down to each ...

Hi Can you please design a logo of a welder pouring a hard solo into a HARD SOLO glass out of his welding gun with a VB can in a trash can. i would also like the caption "THE HOUSE POUR" in there too

Merhabalar. Kıbrıs'ta yaşıyorum. Daha önce canlı destek tecrübelerim oldu fakat bu bahis siteleri üzerine değildi. Yaptığım veya baştan öğrendiğim her işi hızlı bir şekilde öğrenme ve tam performanslı bir şekilde çalışabilen bir kişiyim. Laptop, telefon, hızlı internet, uzak masaüstü bilgisi, orta seviyede web tasarım bilgisi, photoshop vb. uygulamalarda tam bilgi vs. özelliklerim vardır. Tekliflerinizi bekliyorum!

I'm in need of an experienced PBX / VOIP / SBC engineer who can address several issues with our customers phone systems system. The primary goal of this project is to troubleshoot and maintain current systems. Key Responsibilities: - Troubleshoot ongoing call quality issues - Investigate and resolve call drops - Address any connectivity problems Skills Required: - Extensive experience with Asterisk and other PBX systems - In-depth knowledge of VOIP network architecture - Proven track record in troubleshooting and maintenance Please only apply if you have a strong background in VOIP technologies and are confident in your ability to resolve issues.

I'm in need of a SIP and Asterisk expert to help troubleshoot issues with a SIP interconnect between two companies, focusing purely on voice communication. Key responsibilities include: - Identifying issues within the existing setup - Repairing and configuring the SIP and Asterisk system Ideal skills and experience include: - Proven experience with SIP and Asterisk systems - Strong troubleshooting abilities - Understanding of VoIP technologies - Excellent communication skills

I am looking for an Asterisk/SIP expert to help me configure a SIP trunk. Specific tasks include: - Configuring the SIP trunk on my Asterisk server - Assisting with troubleshooting any issues that arise during the setup process Requirements: - Expertise in Asterisk and SIP configuration - Experience with setting up SIP trunks - Familiarity with troubleshooting Asterisk setups Additional information: - I already have a SIP provider - Ongoing maintenance assistance will be required after the SIP trunk has been configured.

vb 2012 video and sound recorder. Auto record to file when motion/sound is detected. Auto save file if no motion/sound is detected for 5 seconds. exe File must be compact and small and not dependent on other dll or ocx. Auto detect existing cam and video device on PC. I should be able to compile it on my PC. Note there are a lot of samples on Chat GTP.

vb 2012 video and sound recorder. Auto record to file when motion/sound is detected. Auto save file if no motion/sound detected for 5 seconds. exe File must be compact and small and not dependent on other dll or ocx. Auto detect existing cam and video device on PC. Note there are a lot of samples on Chat GTP.

I'm in need of a knowledgeable and experienced Asterisk expert for the implementation in our company We need an Asterisk specialist to help us set up a carousel of different numbers and provider accounts. The essence of the task, when calling, automatically should be substituted random number from our list. Details and scheme will be discussed individually

I'm seeking a proficient Asterisk developer who can build a custom PBX system with Issabela or something comparable. The PBX system requirements are as follows: - Less than 10 extensions. - Features such as call recording, auto-attendant, and call routing. - Compatible with VoIP phone lines. Ideal candidate should possess a deep expertise in Asterisk and a good understanding of VoIP technology. Knowledge of Issabela or similar software is an added advantage. Let's connect if you can guarantee a seamless and efficient communication system. For more information, sent the requerimients - The calls received would be answered by several receptionists who would log in/unlog in with their landline to receive the call. If there are more calls than receptionists, a message w...

I'm in urgent need of an ASP.NET and VB expert to help with my ongoing project. The individual should be able to optimize code and implement new features. Key Tasks: - Code Optimization: The project is facing performance issues. I need assistance in refactoring the code to improve efficiency and speed. - Feature Implementation: There are new functionalities I want to incorporate in the project. The ideal candidate should be able to seamlessly integrate these features into the existing system. Skills and Experience: - Proficient in ASP.NET and VB - Previous experience in code optimization is a plus - Ability to implement new features - Strong problem-solving skills - Excellent understanding of software development lifecycle. This is an immediate job, so I need someone...

As a sysadmin developer, I'm in need of an asterisk specialist to build a Docker Compose script or a bash script for an interactive vocal server. This project is multifaceted, carrying out outbound calls and saving responses in a database. Key responsibilities are: * Creation of an Interactive voice response (IVR) system. * Outbound calling function connected with my API for automated scheduling of phone calls. * MySQL database integration to securely store the recorded responses. For this assignment, it would be ideal if you have proficiency in using Asterisk, Docker Compose, API integration along with comprehensive database management skills It would be a cherry on top if you have prior experience constructing interactive vocal servers. Let's connect to disc...

Job: Change field names in vb source code according to Excel table (from/to)

vb 2012 .net record video and sound. Autosave to file when motion/sound is detected. exe File must be compact and small and not dependent on other dll or ocx. Auto detect existing cam and video. Ability to read/write to a registry key.

I require a proficient developer to design a functional asp.net / vb template which will be the foundations of an internal business tool/website. A very BASIC MS SQL schema will be provided for Functionality to interact with. The project includes: The development of a lightweight css, jquery design that is simplistic but still looks ok. Static Pages - Home - Contact Us - About Us Functionality Pages - User Registration - User Login - User self management) - Password reset via email. - User Management admin The sample should show, connecting to an ms sql database. Displaying data through a non defined data source eg (a query enbeded in the code) as well as a defined Datasource. The site should use headers and footers. VS2022, has a sample site, it could be possible to simply...

I'm looking for a professional who can install Asterisk PBX to facilitate a call routing system. Key Requirements: - Asterisk PBX will function primarily as a call router, modifying incoming caller ID's to the outgoing trunk DIDs. - The system should handle both incoming and outgoing calls efficiently. - The endpoint devices that will connect to the Asterisk PBX are Mobile Operator issued SIP trunks. Ideal Skills and Experience: - Prior experience in setting up and configuring Asterisk PBX systems is essential. - Proficiency in handling and routing calls effectively. - Knowledge of SIP trunks and mobile operators' systems would be a plus. Specific Requirements Requirement: A simple Asterisk PBX installed on our server. It is a voice tran...

Hi Mohammed S., We have been in touch regarding PBX some time ago. I need a simple PBX installed that can recieve calls from VOS3000 and route them to SIP trunk provided by operator. The incoming caller I D to be modified to match DIDs provided by the SIP trunk. Also ability to defibe

I'm looking for someone experienced with Asterisk to help me set up a SIP server for educational and testing purposes. The SIP server will be used with a Jio SIP trunk. Key requirements: - Configure Asterisk as a SIP server on the operating system of your choice - Set up a Jio SIP trunk - Create a demonstration of simple dialing using an open source SIP client Ideal skills and experience for this project: - Proficient in Asterisk server configuration - Experience with setting up SIP trunks - Strong knowledge of open source SIP clients - Good communication skills to help guide me through the setup and demonstration process. My budget is not very high ..

Necesito un programa escrito en vb en el framework .net 4.6 y que utilice windows form para la siguiente tarea: > Credenciales del servidor FTP direccion: ftp:// user: android password: android > Descripcion de las rutas del servidor FTP donde el primer path / se ubicaran carpetas con años 2021,2022,2023 hasta la actualidad, ejemplo ftp://, ftp:// en el segundo path / seran carpetas con los meses del año representados con numero 1,2,3... ejemplo ftp://, ftp:// en el tercer path / existiran carpetas con los RFCs de los clientes con un formato similar a este IVD920810GU2, ejemplo ftp://, ftp:// dentro de este

I have a general idea of what I want to achieve. I have done similar thing in the past and can demonstrate to explain the goal. I’m looking for someone which obviously knows winCC and able to write VBS code to achieve goal

...highly-skilled Asterisk VoIP specialist for a unique project. I require expertise in Asterisk integration, VoIP configuration, and particularly in IVR implementation. KEY REQUIREMENTS: - Asterisk Integration: Full integration set up and testing needs to be completed. - VoIP Configuration: This includes configuring phone lines, extensions, and all essential VoIP functions. - IVR Implementation: The main purpose of this project is the implementation of automated IVR menus. This needs to be user-friendly and functional. The system should be capable of handling less than 50 concurrent calls. IDEAL CANDIDATE: The successful freelancer must have outstanding experience in all mentioned areas with a focus on IVR implementation. Any proven record in developing low-volum...

I am in urgent need of an Asterisk developer who can work efficiently on debugging and troubleshooting. Key Tasks: - Fix call dropouts - Resolve audio quality issues - Correct failed call routing The ideal candidate for this project should have: - Strong knowledge of SIP protocols - Experience with Asterisk dial plans - Familiarity with debugging tools and logs Only developers well-versed in these areas need to apply. Achieving solid results in a timely manner is of the essence.

I need a seasoned ASP.NET VB developer with a strong background in updating existing applications. You will be responsible for enhancing and improving the functionality of our current system. Ideal Skills and Experience: - Proven experience with ASP.NET VB - Competence in updating and maintaining existing applications - Strong problem-solving skills - Excellent communication and teamwork abilities Your application should clearly demonstrate your experience with updating existing ASP.NET VB applications. Please don't hesitate to include links to relevant past work.

I see that you have done UPS shipping API's. They are converting everything over to OAUTH 2.0 with their shipping. Is this something you can do or have done? I have a VB project that was built and added to over the last 10 years and updated. It is written in C# and uses MS SQL. Their current API is ending June 5th of this year. I need this switched over to OAUTH. I just use the shipping, rates, and time in transit within my website. Let me know.

I'm in need of a proficient in VB and asp.NET developer, who will help me in the process of creating a web event page . The application should include: The ideal freelancer for this job would be someone with strong skills and vast experience using VB asp.NET in the development of web applications. Proficiency in managing user login data and integrating existing databases is also a must, along with solid problem-solving skills and attention to detail. The project requires deep knowledge of these areas, and I have high expectations for the final product's quality and efficiency.

Preciso de um WebRTC Proxy para conectar nossos antigos sistemas asterisk em webphones. Ele tem que suportar conexões ipv4 e ipv6. Ou seja, precisamos de um Proxy que faça a conexão dos clientes WebRTC tanto ipv4 quanto IPv6 e entregue as chamadas na rede local. Precisamos de pessoas com experiência em kamailio, opensips, rtpengine, asterisk, freeswitch, MariaDB.

I need an experienced professional to help fix an urgent problem in my Asterisk system that utilizes both Session Initiation Protocol (SIP) and Real-time Transport Protocol (RTP). My issue revolves around tenant to tenant recording or IVR. Specifically, all audio plays for only 2 seconds before abruptly ending calls. - Skills and Experience You should have extensive experience with Asterisk, SIP, and RTP. A deep understanding of their inner workings and potential pitfalls is necessary to effectively troubleshoot and resolve the current issue. A track record for quick and efficient problem solving is essential. Deliverables: - Diagnose the issue causing the audio and calls to end after 2 seconds - Implement a reliable solution to fix the issue Note that this project deman...

I am looking for a skilled Python developer who specializes in VoIP and PJSIP development. The successful candidate would ideally have experience creating SIP trunking solutions focused on handling incoming and outgoing calls with a Python bot. Key Features: - Set up S...Dialing(DID) support for calls between multiple company sites. - Configure the Python bot to manage incoming and outgoing calls. Bot Functionality: - Answer and route incoming calls to appropriate destinations. - Initiate outgoing calls based on specific triggers or events. - Handle real-time call transfers and call forwarding. Skills Required: - Proficient in VoIP and PJSIP development using Asterisk. - Strong Python programming skills. - Experience with SIP trunking and DID. - Familiarity with analog to VoIP co...

I am looking for a skilled Python developer who specializes in VoIP and PJSIP development. The successful candidate would ideally have experience creating SIP trunking solutions focused on handling incoming and outgoing calls with a Python bot. Key Features: - Set up S...Dialing(DID) support for calls between multiple company sites. - Configure the Python bot to manage incoming and outgoing calls. Bot Functionality: - Answer and route incoming calls to appropriate destinations. - Initiate outgoing calls based on specific triggers or events. - Handle real-time call transfers and call forwarding. Skills Required: - Proficient in VoIP and PJSIP development using Asterisk. - Strong Python programming skills. - Experience with SIP trunking and DID. - Familiarity with analog to VoIP co...

Seeking an experienced Asterisk developer to optimize the call quality of our existing VoIP system within our business operations. The ideal candidate must: - Possess 3+ years of experience in the domain - Be proficient with programming languages, VoIP, Asterisk interfaces (ARI, AMI, AGI), SIP configuration, API integration, and webhooks - Have robust problem-solving skills to provide innovative solutions Key responsibilities will include scrutinizing our present setup, identifying weaknesses, and implementing improvements to enhance call quality. A solid understanding of business requirements is vital to ensure the VoIP system is modified to suit our operational needs. Interested candidates, please email your resumes and cover letters.

...integrate Salesforce Open CTI. The primary goal for this project is to modify and fix security issues in existing code of an open CTI adapter and making a managed package for market place. Key Responsibilities: - Integrate Salesforce Open CTI: I need someone who can successfully integrate Salesforce Open CTI into our system. - Develop Open CTI Adapter: The main goal of this project is to develop a custom open CTI adapter. Ideal Skills and Experience: - Extensive Experience: I'm looking for someone with a proven track record of successful Salesforce Open CTI integrations. - Salesforce Expertise: A deep understanding of Salesforce architecture, configuration, and development is essential. - Open CTI Proficiency: You must h...

I'm looking for a developer to create a two-page website calendar for showcasing events utilizing ASP.NET and VB code. The project entails two key components. 1. Admin Page - You'll be coding an admin page that provides the ability to add new events. Even though I've skipped on choosing specific features for this page, keeping it functional and user-friendly is a priority. 2. Public Page - The public page's primary purpose is to display these events. While I haven't specified the exact display format, you should aim for a clean, easily navigable design, keeping viewer accessibility in mind. Ideal freelancer skills: - Strong experience with ASP.NET and VB Code - Demonstratable experience in user interface development - Good understanding of effici...

I am in need of an expert data professional to handle distinct tasks pertaining to Excel spreadsheets. Here is a rundown of what you'll be required to do: - Upload numerous Excel files - Expertise in Excel VBA, Macros and VB Capabilities - Analyze data professionally, using descriptive statistics The ideal candidate for the project would be well-versed in using Excel to analyze data and create descriptive statistics. Familiarity with data cleaning and visualization techniques would be a bonus. I look forward to your submissions.

I need a 10-20 page research paper on Cyber Threat Intelligence (CTI) that will be submitted for publication in an IEEE journal. The paper must be written in an academic style and be suitable for a readership of fellow researchers in the field. Requirements: - Expertise in Cyber Threat Intelligence: You should have a solid understanding of the theory and practice of CTI, including its applications and methodologies. - Academic Writing Skills: Ability to write in an engaging, clear, and academically rigorous style. - IEEE Publication Experience: Preferably, you should have previous experience with IEEE publications and be familiar with their submission requirements. Please submit a proposal detailing your relevant experience in this field, along with a timeline for completi...