Create simple dialog box vb net2005 code punët
ping me
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
test porject test porject test porject test porject test porject test porject test porject test porject test porject
Desgin an Admin Theme for simple HTML Web Site
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
I need a clean, professional Wordpress website created for my brand. It must be simplistic, user-friendly, and designed to cater to B2B customers. The primary purpose of this website is to ser...simplistic, easy to use layout that still looks professional - A design that specifically caters to B2B customers - The ability to display a variety of products without overwhelming visitors - A responsive design that looks good on all devices - SEO-friendly structure and content Ideal Skills: - Proficiency in Wordpress and its themes - Experience in creating B2B websites - Design ability: keeping it simple, yet professional - Knowledge of SEO best practices to implement on the website. Please provide examples of your previous work, especially if you have experience with creating similar...
We have a non-trivial design built in Figma. We need a WordPress theme built to match that design. The desktop version is ready. This job also includes building the mobile version, according to what our designer will create soon in Figma. See the attached document for our requirements, as there are some details there.
I'm looking to buy a complete and *READY* code for a football management browser game (like Hattrick, Trophy Manager, etc.). Essential features include: - Registration - Team creation and player management - Tactics creation - Transfers - Game simulation - Leagues system. Preferred technologies are JavaScript and C#, but others are acceptable. I'm also open to offers for partially finished games.
I'm in need of a unique and innovative logo to boost brand recognition. The design should be memorable, easily recognizable and stand out from the competition. While I'm open to all styles, I'm particularly interested in seeing fresh and out-of-the-box ideas that can make my brand truly distinctive. Ideal skills and experience for this job: - Strong portfolio with a track record of creating innovative and creative logos - Proficiency in graphic design software - Ability to understand and execute brand recognition principles - Understanding of various styles and trends in the logo design industry Please submit your portfolio and provide examples of innovative work you've done in the past. Your bid should also include details on your approach to creating a logo t...
I am looking for a developer who could develop a iOS IPhone app. It should do following Use a authentifcation based on a MySQL database table (for login) store that login as session that I not need each time again login. Create a connection between that MySQL and grab data and display that on app. Store that data like on cache that I can see that data also offline. I only will answer to developer who native language are English or German and who could show some iOS work.
I'm in...proficient Python developer who can help compile a Python code, that I have acquired from GitHub, into an executable format for Windows. As the client, I expect: - Understanding the existing Python code and its dependencies - Transforming the Python code into a Windows executable file Successful freelancers should provide a detailed project proposal illustrating how they plan to compile the code to exe on a Windows operating system. Though no specific Python libraries or frameworks were mentioned, a background in Python coding and debugging is paramount. The ideal freelancer should have a deep understanding of Python code, dependencies, and experience dealing with code from GitHub. Experience in generating Windows executable files...
Hello I am looking for an experienced freelancer to help me create an account on , an online translation platform. The selected freelancer will not only be responsible for creating the account but also have the opportunity to use the account for their own translation needs. **Requirements**: * Hold a valid translation certificate or degree in one of the following languages: + English to French, Spanish, Italian, Japanese, or Chinese * Provide a detailed CV highlighting your translation skills and experience * Be able to pass 's verification process with your valid translation certificate or degree **Tasks**: * Create a account with the client's provided information * Configure the account for shared access * Provide login credentials for the client to
...need of a skilled Delphi developer, well-versed with Delphi 5, to work on an existing software project. The goal is to both fix bugs and enhance the software with new features, ultimately improving its performance. Key Responsibilities: - Identify and address issues causing certain features not to work - Implement necessary bug fixes - Integrate new features in a seamless manner - Optimize the code for improved performance familiar with firebird database and report builder. Ideal skills and Experience: - Strong background in Delphi development, specifically with Delphi 5 - Proven track record of fixing bugs and enhancing existing software - Understanding of software optimization techniques - Ability to work effectively both independently and as part of a team - Strong probl...
I am looking for a skilled programmer to develop an interactive chemistry experiment for me. You may code using JavaScript, HTML5 or using Python, so experience or proficiency in this language is crucial. Key Requirements: - Users should be able to drag and drop objects using mouse or in case of mobile- fingers. - It should offer a moderate level of interactivity. This includes features such as adjusting quantities and temperatures. If a user pours something in a beaker, it should show the beaker full. If emptied, beaker is empty. - Vector images of lab equipments like Test tube, beaker, burner etc can be found online. Ideal Skills: - Proficiency in Python or JavaScript. You may use CreateJS libraries. If you are a programmer with a passion for chemistry, this is a great opportu...
We are seeking a talented designer to create a captivating 15-second header GIF for our website. The GIF should showcase the beauty of Madagascar's rainforests and vanilla plantations, capturing the essence of our brand. GIF Sequences: 1. Aerial: Flying in the Rainforest of Madagascar - Find the best aerial footage of Andasibe-Mantadia National Park in Madagascar. - Reference videos: - - 2. Wood Riverboat Crossing the Rainforest in Maroantsetra, Madagascar - Find the best footage of a wood riverboat crossing the rainforest in Maroantsetra, Madagascar
Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.
Project Description: We seek a highly skilled software developer to compile the ARM64 code from GitHub, based on Golang 'go'. Your role is crucial in ensuring the Velociraptor server operates flawlessly on the Odroid N2+ platform (4GB RAM) by creating an installer or Debian package (.deb) that functions flawlessly on Debian Ubuntu 20.04 (MATE Desktop). The ARM64 code is available online, and we wish to have it as a package so the user can run it and go through the setup of the velociraptor server seamlessly on the N2+, use the local webserver to create agents (sensors as MSI or exes) and analyse/collect remote endpoints using the open source tool on the box. This project involves adapting the Velociraptor software, an open-source security tool , ...
...Need: • Creativity and Innovation: We’re looking for unique, out-of-the-box ideas that will captivate and engage our target audience. • Expertise in Social Media: Deep understanding of the algorithms, trends, and best practices specific to TikTok, Twitter, and Instagram. • Content Creation: Ability to produce high-quality, engaging videos, graphics, and posts that align with our brand voice and resonate with users. • Campaign Management: Experience in planning, executing, and optimizing social media campaigns to drive app downloads and user engagement. • Analytics and Reporting: Proficiency in tracking and analyzing performance metrics to refine strategies and demonstrate ROI. What You’ll Do: • Develop Strategy: Create a comprehen...
Looking for someone to develop a simple mobile app that will work on both iOS and android. That would mean utilizing one of those frameworks such as React Native or Cordova (or something else similar). The app will basically just allow the user to search for an order (done through a Rest API) and then select photos on the device and upload those to the selected order (also though a Rest API). Detailed Requirements: Setup screen where system URL and API key can be entered and then saved so subsequent uses of app doesn't require it to be reentered Ability to search and find order using order number, customer name, or company name Ability to select multiple photos and upload at once (although API call needs to be made for each file) Ability to take picture with camera right i...
I'm looking for an Android developer to create a simple news app for me. The key feature that I'd like to prioritize is an offline reading capability, which is essential for my users who may not have constant internet access. The news articles should be displayed in a list of headlines. This layout will allow users to quickly scan through the news and pick out articles of interest. The ideal candidate for this project would be a developer with experience in Android app development, particularly in working with APIs. Experience in designing user-friendly and intuitive interfaces would also be a plus.
i have script .js i want convert it to powershell .ps1
I am currently working on a JavaFX project that is in need of...graphical charts and visualizations. However, the Graphical User Interface (GUI) needs enhancement to ensure a better user experience. • Finish the incomplete JavaFX code and make the project work properly. • Enhance the GUI – it should be pretty straightforward for someone with your skills. • Ensure that the GUI makes logical sense and applies well to the rest of the code. The ideal candidate for this project should be an experienced JavaFX coder comfortable with GUI enhancement implementations. Having excellent attention to detail and problem-solving skills will be a plus. so milestone3 is my last task and the zip file contains my code that need to be completed with the task i adde...
Please read content of requerments I am seeking an experienced 360 marketing specialist for my social media platforms which include Facebook, Instagram, LinkedIn, and Twitter. The successful candidate will need to be a native Spanish speaker. To sell Point of sale For B2B sells of software Key responsibilities include: - Creating engaging and compelling content that will resonate with my target audience - Designing and implementing a comprehensive social media strategy aimed at driving sales - Creating and designing the Ads - Monitoring and analyzing metrics to ensure the effectiveness of campaigns
Coding of trading view indicator to requirements provided for divergence of chart price and two separately provided overlaid lines.
I need to scrape data from a website. I'm stuck with an error. I used improtxml to scrape data from a class in a website I know. However, the fact that this website has classes has a problem: . While on page 1 there will be that text data, but on many pages, that text data is not there and it is accidentally pushed up to insert the class data below into the previous class data. To m... To make it easier to imagine, there will be 4 rows. I will need to get a fix for each row into the google sheet. However, there are pages where I insert the link and there will be no row 3 or row 2 and then row number 4 will be inserted into row number 3, making the data incorrect. I need improxml to automatically check the syntax, if it is correct, it will be filled in and if it is wrong, the box...
I am looking for an 2-d artist NOT LOGO DESIGNER to create a unique heraldic image for me(you will be provided with references). Please look at my attached example for reference so you can see my expectation both in terms of style and complexity. If you are interested, please send examples of your previous work for consideration. (You will not be considered without submitting examples of your previous work, it is not my job to go to your profile and search) Compensation is $50 cad! If this is not enough, I completely understand, no one should be asked to do a job for pay they don't believe is enough. All I ask is you simply don't apply, and instead apply for the jobs that where the pay is agreeable to you.
...setColor(Integer color) { = color; } and in parser class (INTENSITY, ((), 0)); The problem is sometimes the Api giving the color value as string not as interger but only on on checkbox config we add and this already defined in java if(checkVariant is true) then consider it string and parse it what i have to do to fix my code based on that condition so i can parse the string value this way: updateProperties("color", ((), )); how i can solve this issue so in case checkVariant is true then parse it as string otherwise leave it as it is now which integer. can i do that only on parser or i need to change the Pojo class as well (colorWsDTO) who can do it in
...customer database from Quickbooks in CSV format. Key Functionalities: - Creation and Editing of Jobs - Ability to use system on-site / remotely through the use of iOS or Android web browsing. Some - Ability to select a simple job status from a drop-down combo box eg. In-progress, waiting for collection, waiting on parts, not started, completed. - Ability to search by customer, PO number, job status, date, part on both active jobs and completed archived jobs in the past. - Ability to allow the upload of PDF files, pictures, notes etc for each job. - Ability to allow simple addition of parts for the job, these are then stored within the system and can be searched for and used for future jobs (also ability to edit / delete part). - Ability to export each completed j...
I'm seeking a creative individual who can craft a unique, brandable domain name for my web and software development company. The domain should be memora...Requirements: - The domain should reflect that I am a company focused on software and web development. - It should be suitable for targeting enterprise companies. - A catchy and engaging name is a plus. - Some keywords from my side like=> "Dev", "mind", "Pro", "Next" etc but I am open to your idea Ideal Freelancer: - Proven experience in domain name generation. - Creative and able to think outside the box. - Familiarity with the tech industry, especially web and software development. - Strong understanding of branding and target audience. Note: A great domain name will be rewarded...
Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.
I have made an extension which likes posts of fb one by one and after 5 seconds, page refreshes and then likes new post again one by one. The post which is already liked remains as it is. I am facing an issue that after 1 hour my I'd gets logged out. Mujhe bas yeh chaiye ki vo Waps se login ho jaye I can pay max : 600 rupees
I'm in need of a designer who can create a beautiful and functional labels and box design for my cosmetic product. The final product should reflect a modern, minimalist style, aligning with our brand vision of simplicity and elegance. - Ideal designer should have experience with: - Packaging design - Branding for cosmetic products - Minimalist aesthetics - The design will be utilized for product packaging to enhance brand visibility and consumer interaction. - A strong understanding of how a simple and sleek design can impact product perception is necessary. - Knowledge of industry trends and an ability to integrate them in a way that aligns with a minimalist design ethos will be highly beneficial. Please provide a portfolio of previous work, espec...
I want to present my boyfriend and his best friend who are turning 40 together with a laugh by merging their faces into the iconic film poster for "Stepbrothers." I'm looking to replace the faces of Brennan Huff and Dale Doback in the poster with my friends' faces. The date should be June 8th 2024 and change Will Ferris name to Brent Svendsen and Jim O’riley to Russ Schulhauser. Must be able to have this sized up enough to print as a poster. For this project, I will provide high-quality photos of my friends that will need to be edited to match the tone and style of the poster to ensure the final product looks as realistic as possible. Ideal Skills: - Proficiency in Adobe Photoshop or similar photo editing software - Previous experience in editing photos into m...
I am looking for a Python developer who can implement concepts from a research paper. - The dev...paper. - The developer must have solid experience in Python, ideally with an intermediate understanding of complex programming concepts. They should be comfortable with an intermediate level of complexity in translating research concepts into code. - Knowledge and experience with the PyTorch framework is a must. The freelancer will need to use it to implement the code from the research paper. This project will require a good understanding of data structures, algorithms, and object-oriented programming in Python. Experience with prior work involving code implementation from research papers would be advantageous. Please only bid if you meet these qualifications and c...
...toxic working environment 2. Agile, Responsive, and Fast Delivery 3. Collaborative as a team 4. Responsible, Credible, Reliable and Integrity person 5. No agency, only direct hiring ------ I'm looking for a skilled DevOps professional who can help in maintaining my server code. As the DevOps server code maintainer for this project, you will be responsible for: - Server Configuration and Setup: Ensuring the smooth operation of our Linux Debian SSH server. - Code Deployment and Version Control: Managing our PHP and SQL code deployments, including version control. - Monitoring and Troubleshooting: Monitoring the server's performance, and troubleshooting any issues that may arise. The ideal candidate should have experience with PHP, SQL, Linux Debi...
I need a cabinet drawing created based on the attached detailed illustrations. Need to add some minor details (ventilation holes, eye bolt etc) to reflect the actual cabinet. The final deliverable should be as per attached example in PDF format. -Need done urgently by Today. -Final version to be provided in PDF format.
Integrate payment gateway. Payment gateway dont have suitable sdk for flutter. Flutter App.
this is a static page, i need to create dynamic add of posts from top box. top box is like facebook with a create button, then you should list the posts. in the first box you need to add category (an empty select with cat1 cat2 cat3) a calendar date and an autocomplete for searching country-city ok? i will provide you api and project on github so im here for anything that is related to backend - create post - retrieve post - edit a bit the card
Code Upgrade for BuddyBoss App Customization
Just create db for a form only. To save value from form.
More details: Which specific UI change would you like to make to the app? Change color scheme What is the primary color you want for the app's color scheme? Blue Do you require any additional features to be added to the app? add logo
Im hoping to make an anniversary gift. I'm looking to collaborate with an experienced game developer to create a platformer console game specifically for the Nintendo platform. The ideal freelancer for this project would have: - Expertise in console game development, specifically for Nintendo - Proven experience in creating engaging action-adventure games - A keen understanding of the technical specifications and requirements of Nintendo consoles - Strong problem-solving skills and the ability to think out-of-the-box to deliver a unique gaming experience Prior experience with Nintendo game development will be highly advantageous. I look forward to seeing your bids and discussing your relevant experience and ideas for this project.
I have 11 simple digital imags that I need converted to an .STL file so I can have it 3D printed. The design contains basic geometric shapes and lacks complex curves or textures. Key Requirements: - Convert a simple digital image into an .STL file for 3D printing - Ensure the file is optimized for 3D printing to avoid any issues during the printing process. Ideal Skills and Experience: - Proficiency in CAD software - Experience in 3D modeling, particularly converting images into .STL files - Understanding of 3D printing requirements and how to optimize files for this purpose.
