Develop outlook addin vb net punët

Filtër

Kërkimet e mia të fundit
Filtro sipas:
Buxheti
deri në
deri në
deri në
Lloji
Aftёsitё
Gjuhët
    Shteti i punës
    2,000 develop outlook addin vb net punët e gjetura, me çmimin EUR
    Programing Ka përfunduar left

    Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc

    €11272 (Avg Bid)
    €11272 Oferta mesatare
    4 ofertat
    Crie um Website Ka përfunduar left

    Desenvolvedor .NET MVC, SQL e ADVPL Protheus

    €2737 (Avg Bid)
    €2737 Oferta mesatare
    1 ofertat
    qefqreqweqawdafsc Ka përfunduar left

    asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr

    €184 (Avg Bid)
    €184 Oferta mesatare
    1 ofertat
    yveguwvcjnjnecbkhb Ka përfunduar left

    ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif

    €105 (Avg Bid)
    €105 Oferta mesatare
    1 ofertat

    I'm seeking a dedicated and skilled female sales agent to support my business. In this remote role, you'll be focused on lead generation within the retail sector. Key Responsibilities: - Lead generation: Your primary task will be to identify and develop leads within the retail industry. You'll need to proactively seek out potential business opportunities and convert them into qualified leads. Ideal Candidate: - Sales Experience: Prior experience in sales or lead generation, particularly in the retail sector, will be highly beneficial. - Communication Skills: You should possess excellent communication skills, particularly over the phone, as this role will involve cold calling. - Self-Motivation: Given the remote nature of this position, you should be self-driven and ...

    €13 / hr (Avg Bid)
    €13 / hr Oferta mesatare
    7 ofertat
    Trophy icon Creative "Sold By" Real Estate Logo 2 ditë left

    I need a designer with a professional, minimalist approach to develop a "Sold By Four Leaves" image using elements from my logo that I've supplied. My commercial property business is called Four Leaves, and I want an image I can put on properties I've sold which says "Sold by Four Leaves". You could include some imagery, or it could be a simple word image which says "Sold by Four Leaves". Key elements: - Color scheme: Mainly featuring light green (4fb420), dark green (006440), and white. - Design Style: Should radiate professionalism, akin to a modern and minimalist sensibility. - Imagery: I invite creative suggestions and ideas. While I didn't specify particular elements to be included, ensure it communicates the 'Sold By' ...

    €30 (Avg Bid)
    I garantuar
    €30
    55 kandidaturat

    ...different names, email accounts and numbers I am in need of a specialized designer who can create a professional email signature design for Microsoft Outlook. This design should be clean, crisp, and reflect my professional brand image. Key items to include: - Contact information: name, job title, phone number, and email address should be clearly represented in the signature. - Company logo: Integration of my company logo within the layout in an aesthetically pleasing manner. Freelancers bidding on this job should possess the following skills and experience: - Proven experience in email signature design, particularly for Microsoft Outlook. - Strong graphic design skills to ensure a visually appealing signature. - Attention to detail to accurately represent requested cont...

    €64 (Avg Bid)
    €64 Oferta mesatare
    30 ofertat

    I'm looking for an experienced designer who can give my YouTube channel a fresh new look, adhering to a modern and minimalistic style. The primary elements I need are a new channel logo and banner. Key requirements: - Develop a modern and minimalistic style to match my branding - Create a new channel logo - Design a fresh channel banner Ideal skills for this project: - Strong graphic design skills - Experience in branding and logo design - Proficiency in design software (Adobe Creative Suite, Canva, etc) - Understanding of YouTube's branding guidelines Attached are currently in use.

    €68 (Avg Bid)
    €68 Oferta mesatare
    59 ofertat

    ...batteries. Key points to consider for this project: Skills and Experience • Understanding and experience in working with various battery types • Proficiency in Matlab for creating simulations and testing • Strong analytical modeling skills Project Objectives • Provide research and suggestions on optimizing battery life, decreasing charging time and improving power output. • Develop a comprehensive Matlab model suitable for variety of scenarios. • Evaluate optimization results using different methodology – simulation and testing, analytical modeling or field testing. Please ensure you have in-depth knowledge in this field, assisting me in achieving optimal results. Besides, great communication skills and commitment t...

    €10 (Avg Bid)
    €10 Oferta mesatare
    8 ofertat

    I'm looking to set up an online store where I can sell unique physical goods. I will not need to manage inventory as each item is distinct. The website should be equipped to handle credit card and PayPal transactions. Key requirements: - Develop an e-commerce website that can handle unique, physical products. - Implement a user-friendly interface for easy browsing and purchase. - Ensure secure payment gateways for credit card and PayPal transactions. Ideal skills for this project include: - Proficiency in e-commerce website development. - Experience with unique inventory management systems. - Knowledge of secure payment gateway integration.

    €466 (Avg Bid)
    €466 Oferta mesatare
    80 ofertat

    I need a database where we can store our sales transactions. The database will be manually updated by our staff. I would also like to have reports generated on our sales. Key Requirements: - Develop a database to store sales transactions - Enable manual data entry by staff - Implement a reporting system that can generate sales reports Ideal Skills: - Proficiency in database development - Experience with manual data input systems - Ability to create custom reporting features Please provide examples of previous similar projects you've worked on.

    €33 / hr (Avg Bid)
    €33 / hr Oferta mesatare
    35 ofertat

    I'm seeking for a talented architect with strong experience in designing modern residential houses. Your role will be to develop an innovative yet functional design that fits with our aesthetics. Key Responsibilities: - Develop architectural designs for a new modern house - Provide a coherent and visually appealing design layout - Collaborate closely with me for inputs and adjustments Ideal Skills and Experience: - Proven experience in modern residential architecture - Strong attention to detail - Good communication and understanding of client needs Please attach your relevant portfolio or examples of previous work in your proposal. I look forward to working with the ideal designer who can bring my vision into reality.

    €352 (Avg Bid)
    €352 Oferta mesatare
    37 ofertat

    ...capable .NET developer to create a WebAPI using the Visual Studio template "WebApi Net core (Minimal api)". It needs to have Authentication and Authorization in place, using the X-API-Key. Key Requirements: - Authentication and Authorization: You need to enable X-API-Key based authentication and authorization for this WebAPI. - Data Model: The WebAPI will manage a simple 'City' table, performing basic CRUD operations. Expectations: - The X-API-Key should be hardcoded in the application. - The WebAPI should be developed using .NET 8.0 and the Visual Studio template "WebApi Net core (Minimal api)". - Data access should be implemented using EFCore. - Authorization should be handled through middleware. Ideal Skills and Experie...

    €30 (Avg Bid)
    €30 Oferta mesatare
    6 ofertat

    ...with expertise in Bubble and CRM integration? We're looking for someone like you to join our team on a freelance basis and help us bring our vision to life! Project Overview: We're seeking a skilled developer to design and develop an app using Bubble that seamlessly integrates with our CRM system. The app will streamline our processes, improve efficiency, and enhance user experience by providing a user-friendly interface for managing contacts and data. Key Responsibilities: Collaborate with our team to understand our CRM system and business requirements Design and develop a user-friendly app using Bubble that integrates seamlessly with our CRM Implement features for managing contacts, data entry, and reporting Ensure the app meets our standards of quality, pe...

    €429 (Avg Bid)
    €429 Oferta mesatare
    35 ofertat

    unban ip/domain from outlook's blacklist

    €23 (Avg Bid)
    €23 Oferta mesatare
    1 ofertat

    I am seeking an experienced .NET developer to build a highly dynamic REST API using the .NET 8 framework. The API will be designed to manage interactions with a database using a single, generic controller capable of handling all database tables. This project will involve implementing advanced features such as column selection, filtering, sorting, pagination, and complex table relationships like aggregations and master-detail references. Core Requirements: 1. API Framework: The API should be developed using .NET 8. I am open to using either OData or GraphQL for the API architecture, depending on what the developer finds most suitable for the project requirements. Alternative suggestions are welcome for discussion. 2. Generic Controller: The API should feature a single...

    €496 (Avg Bid)
    €496 Oferta mesatare
    53 ofertat

    I am in need of a skilled email marketer who can target potential clients within web design agencies. The goal of this campaign is to promote a particular product awareness and sales Key Responsibilities: - Develop a strategic email marketing campaign that allows us to effectively deliver our message to web design agencies. - Potentially recommend and implement email marketing software, if it aids in increasing efficiency and effectiveness. Ideal skills and experience: - Proven experience in executing successful email marketing campaigns - Specific experience targeting web design agencies is a plus. - Working knowledge of renowned email marketing software. - Excellent written communication skills - Strong understanding of B2B marketing - Ability to analyse email marketing statis...

    €28 - €233
    I vulosur
    €28 - €233
    4 ofertat
    MiningWeb.io 6 ditë left

    I'm in need of a talented Web3 developer to work on a decentralized application (dApp) for a DeFi gaming platform. The ideal candidate should be proficient in Smart contract development, Solidity programming, and Blockchain integration. Additionally, skills related to NFTs and art (Web3 artist) are highly desirable for this project. Key Responsibilities: - Develop and deploy smart contracts on the blockchain - Implement and integrate blockchain technology for the dApp - Design and integrate NFTs and other art-related aspects into the platform Functionalities Required: - User authentication - Token trading - Voting system Ideal Skills and Experience: - Previous experience in DeFi or gaming dApp development - Strong knowledge in Smart contract development, Solidity programming...

    €33 / hr (Avg Bid)
    €33 / hr Oferta mesatare
    61 ofertat

    I need an expert in Microsoft 365 and Outlook to configure my email accounts and set them up ready for use with Power Automate and Microsoft Defender. Key Requirements: - Expertise in Microsoft 365 and Outlook email configuration - Proficiency in setting up email accounts - Experience in using Power Automate to automate email workflows and integrate with other tools or platforms - Knowledge of Microsoft Defender The goal is to have my emails set up efficiently and securely, with the ability to automate workflows and integrate with other tools/platforms, all while ensuring the highest level of security with Microsoft Defender. Your role would be to configure the email accounts, set up Power Automate for email workflows, and integrate it with other tools/platforms. Configu...

    €45 (Avg Bid)
    €45 Oferta mesatare
    4 ofertat

    I'm looking for a Facebook Ads expert who can help me generate leads. Key Requirements: - Experience with lead generation campaigns on Facebook - Proficient in targeting older demographic (65+) with high net worth - Ability to focus on a specific local area I'm in need of someone who can craft ads that speak directly to high net worth adults in a specific local area. The primary goal is to generate leads, so it's crucial that the ads are not only engaging but also have a clear call to action that encourages these individuals to express interest in my services. It's very important that the freelancer has a deep understanding of Facebook Ads, including the platform's ad targeting capabilities. Previous experience with similar campaigns targeting a s...

    €149 (Avg Bid)
    €149 Oferta mesatare
    22 ofertat

    We are seeking a highly skilled PCB designer to develop a custom board featuring the RP2040 microchip to control multiple DC motors and MOSFETs, with integrated voltage regulation. This project requires expertise in high-power applications, voltage regulation, and serial communications. Project Requirements: Microcontroller: RP2040 chip to manage all operations. Power Handling: Board must handle input of 24V. Voltage Regulation: Conversion of 24V input to 12V and 5V outputs. MOSFETs: 5 MOSFETs for 24V, 7A control. 4 MOSFETs for 12V, 5A control. Communication: USB Type-C for robust serial communication. Inputs and Outputs: 2 analog inputs. 1 One Wire communication interface. Additional pins for digital input/output as required. Deliverables: Complete PCB design files ready for man...

    €129 (Avg Bid)
    €129 Oferta mesatare
    9 ofertat

    I'm in need of a professional who can create an innovative AR navigation guide for tourists. The ultimate goal of this project is to develop a tool that makes exploring new cities and regions engaging, interactive, and informative. Key Features: - The AR navigation guide should be accessible as both a mobile application and website - The main platform for the application should be Android - The app should incorporate real-time location tracking and landmarks identification features to enhance user experience. Ideal Skills and Experience: - Proficiency in AR development - Experience in mobile application and website development - Strong knowledge of Android development - Previous work with real-time location tracking and landmarks identification would be advantageous - Creativ...

    €157 (Avg Bid)
    €157 Oferta mesatare
    22 ofertat

    I'm looking for a skilled professional to automate the task of entering data from specific Outlook emails into a structured format. The ideal candidate will have experience in: - Automating data entry tasks, and particularly from emails. - Working with Outlook's API or related tools. - Developing scripts or software to extract and categorize email content based on specific criteria. Key requirements include: - Extracting and processing data from emails based on criteria like sender's identity and keywords. - Ensuring the data is accurately transcribed and structured according to a predefined format. - Ensuring the process runs smoothly and efficiently, with the ability to handle a large volume of emails. - Providing a user-friendly solution, which could potentially ...

    €113 (Avg Bid)
    €113 Oferta mesatare
    27 ofertat

    The purpose of this project is to write Visual Basic .NET code that interacts with the PayPal API to generate payments What I need: that will: - Obtain the access_token using OAuth2. - Create a payment. - Execute the payment. will: - Retrieve the response triggered by PayPal and process it accordingly by determining if the payment was successful or not. - If the payment wasn't successful, display a message saying that no payment was made. - If the payment was successful, display the details of the operation returned by PayPal. If you want to participate to this project please copy/paste this sentence in your bid "I have been working with PayPal API and I have got proficiency in Visual Basic .NET"

    €30 (Avg Bid)
    €30 Oferta mesatare
    9 ofertat

    As a sommelier, I'm establishing a new business that involves private wine tasting experiences. I'm looking for a talented social media manager and content creator to help build the brand's presence online. Feel free to look at my website to get a feel for the brand Key Responsibilities: - Develop and execute a social media strategy on Facebook, Instagram, and Tiktok - Curate engaging content that aligns with our brand and resonates with our target audience - Post three times a week on each platform - Create educational content about wine and behind-the-scenes insight from our tasting experiences - Implement promotional content and special offers Qualifications: - Proven experience in social media management and content creation - Strong understanding of the wine ...

    €330 (Avg Bid)
    €330 Oferta mesatare
    42 ofertat
    Entertaining Kids Video Creator 6 ditë left
    VERIFIKUAR

    I'm seeking a talented content creator to develop engaging video content for children. Key Requirements: - The primary goal of the videos should be entertainment, so I'm looking for someone with a flair for creating fun, engaging videos that can captivate a young audience. - Ideal candidates will have experience in creating content for children, understanding what engages them and keeps them watching. Please include relevant samples of your previous work, particularly any content that you've created for a younger audience.

    €20 / hr (Avg Bid)
    €20 / hr Oferta mesatare
    19 ofertat

    I'm seeking a professional who can assist in generating leads and potentially converting them into clients for my window cleaning business. The leads should be specific to suburban neighborhoods and residential areas, with a primary aim of increasing sales. Key Responsibilities: - Identify and gather leads from the specified suburban neighborhoods. - Develop strategies to convert these leads into potential clients. - Prioritize on generating leads that have a higher likelihood of converting into sales. - Maintain a professional and engaging approach towards potential clients. Free Trial Opportunity: As part of our hiring process, we're offering a free trial period to assess your ability to generate leads effectively. During this trial period, you'll be tasked with ...

    €3 / hr (Avg Bid)
    €3 / hr Oferta mesatare
    7 ofertat
    E-Commerce Website Development 6 ditë left
    VERIFIKUAR

    I'm looking for a skilled developer to create a business website, and I'm open to using either PHP or .NET. Key requirements for this project include: - Implementation of a robust and user-friendly payment gateway integration for seamless transactions. - Integration of a feature that allows businesses to list their business for sale listing on the site. Your experience with development and payment integration will be crucial. Please share relevant experience and approaches in your proposal.

    €450 (Avg Bid)
    €450 Oferta mesatare
    195 ofertat

    ... UI/UX Functionalities Implementation: Implement language and theme changes in the user interface; the template already includes this functionality but it must be customized and extended as necessary. Develop customizable widgets for the dashboard that allow for efficient visualization of data and relevant metrics. Create a customizable dashboard that allows users to adjust and configure according to their preferences and needs. Alerts and Notifications Management: Implement alerts, toasts, and modals to enhance user interaction and the presentation of critical information or errors. Develop functionalities for general announcements, both internal from the company and communications directed at client companies. Multi-company Functionality: Provide robust functionality f...

    €444 (Avg Bid)
    €444 Oferta mesatare
    56 ofertat

    I am in need of an experienced educational content creator who can develop a comprehensive set of educational courses for Radiologic Technologists and Nuclear Medicine Technologists. These courses need to be in compliance with ASRT/ARRT and SNM guidelines for self -learning. The goal is to build up to 50 courses. Key Deliverables: - Develop courses on Radiation safety, Radiographic positioning techniques, Imaging modalities, Radiopharmaceuticals, and Therapies provided in Nuclear Medicine. - The courses should be designed for continuing education courses according to ASRT/ARRT and SNM self-learning guidelines. The courses should be provide in Word document form, providing references, test of at least 12 questions with answer key. Ideal Skills: - Proven experience in educati...

    €1910 (Avg Bid)
    €1910 Oferta mesatare
    9 ofertat

    ...design. Requirements: Conceptual Sketches: Rough sketches that outline the basic concept of the diptube design. These sketches should capture the key components and their relationships. Functional Diagrams: Create diagrams that illustrate how the diptube will function within the larger system. This could include flow diagrams to show the movement of fluids through the diptube. Component Layout: Develop a layout of the individual components within the diptube assembly. This will help visualize how everything fits together and identify any potential issues with spacing or accessibility. Mechanical Drawings: Produce detailed drawings of each component, highlighting dimensions, tolerances, and material specifications. These drawings will serve as the basis for creating the 3D mod...

    €428 (Avg Bid)
    €428 Oferta mesatare
    21 ofertat

    As a growing organization catering specifically to homeowners and potential home buyers, we need skilled graphic designers to develop our comprehensive brand guidelines. This will include essential design elements like: - Logo - Typography - Color palette Our brand appeals to individuals interested in purchasing or who already own homes. As such, your designs need to be clean, engaging, and inclusive - building trust and relatability. Although specific design styles weren't stated, we welcome creativity. Present us with your experiences and ideas. Show us that you're able to develop a unique, compelling and consistent brand identity that will resonate with our target audience. Ideal skills: - Proven experience in creating brand guidelines - Strong understanding...

    €276 (Avg Bid)
    €276 Oferta mesatare
    147 ofertat
    Web Developer Needed 6 ditë left
    VERIFIKUAR

    Web Developer Needed I am looking for a skilled web developer to create an E-commerce website with custom functionality. Main goal of the website: - E-commerce platform to sell products online Requirements for successful freelancers: Need web developer who can develop my website similar to this () within my budget. Point to be noted It should be user friendly interface It should be easier for me to upload pic or edit pricing or comments Design to coding should be done perfectly. Last but not the least PRICING should be within my budget if someone needs higher amount then please don't apply. Thanks

    €86 (Avg Bid)
    €86 Oferta mesatare
    20 ofertat

    ...ecommerce platforms using GO lang and React JS/Next JS? Project Description: We are in need of an expert developer to create a dynamic ecommerce platform focusing on digital goods and services. The project entails building three main sectors: Front-end Development: Implement user authentication, service listing, and seamless communication with the backend via API. Supplier Backend: Develop functionalities for suppliers to manage products, process orders, and handle cancellations efficiently. Admin Backend: Construct a robust admin panel to oversee order processing, site settings, and overall platform management. System Overview: Showcase popular services through a slider on the front end, adjustable by the admin. Customize service display based on date,...

    €492 (Avg Bid)
    €492 Oferta mesatare
    76 ofertat
    TradeStation Coders 6 ditë left
    VERIFIKUAR

    I'm looking for expert coders who can assist me with implementing various trading strategies in C# on the TradeStation platform. Key Requirements: - Proficient in C# programming language - Experience in developing trading strategies for TradeStation Trading Strategies: - Trend Following: Develop a strategy that identifies and takes advantage of market trends over time. - Mean Reversion: Implement a strategy that capitalizes on the tendency of a market to revert to its historical average. - Breakout Trading: Create a strategy that enters positions when price breaks through a significant support or resistance level. Your role will be to take these concepts and turn them into functional, efficient code that can be executed on the TradeStation platform. The successful candidate ...

    €470 (Avg Bid)
    €470 Oferta mesatare
    36 ofertat
    B2B Email Marketing Campaign 6 ditë left
    VERIFIKUAR

    I'm looking for an email marketer with a knack for clear, professional design. The purpose of my campaign is to drive awareness of my products and services amongst a B2B contacts list. Your expertise will enhance communication with potential clients in a professional and clean layout. Key Requirements: • Develop a professional and clean email template. • Creatively promote our products/services specifically catered to B2B contacts. • Experience in B2B email marketing highly preferred. • Proven ability to deliver an effective email marketing strategy. Excited to work together and build a campaign that will propel my services to new heights!

    €48 (Avg Bid)
    €48 Oferta mesatare
    8 ofertat

    I'm...looking for hands-on assistance in New York City to set up my business email on Microsoft Outlook. This job requires a tech expert well-versed with Outlook setup and management. Here are some of the tasks I need assistance with: - Set up my Outlook email account successfully - Simplify the way I organize and manage my emails - Provide step-by-step guidance on how to maintain the setup in the future Preferred Skills: - In-depth knowledge of Microsoft Outlook - Previous experience in email account setup - Excellent communication and tutorial skills - Ability to solve technical issues - Based in, or able to commute to New York City If you can help me streamline my email management in Outlook, I'd love your expert guidance...

    €33 / hr (Avg Bid)
    Lokale
    €33 / hr Oferta mesatare
    13 ofertat

    I am looking for a WordPress developer experienced with Oxygen Builder and Metabox. Here are the specifications: - Develop a custom WordPress plugin that integrates Oxygen Builder with the Metabox plugin I'm looking for a way to have a set of Group Fields to pull from a Metabox Settings Panel. And then import/ display them in the Oxygen Repeater. It needs to work exactly like it does with ACF. Oxygen is definitely not adding this feature anytime soon. So it needs to work on all Oxygen websites it is installed on. Your understanding of the plugin framework and intricacies of data synchronization is crucial for this job. Looking forward to your bids.

    €531 (Avg Bid)
    €531 Oferta mesatare
    93 ofertat

    I'm seeking a skilled and experienced digital marketer to modify campaigns on both Google and Bing Ads. Key Responsibilities: - Develop and optimize ad campaigns on Google and Bing to generate leads. - Analyze and report on campaign performance - Proactively suggest and implement improvements to enhance effectiveness. - Ensure targeted advertising content reaches and appeals to the over 60 age group. Ideal Skills and Experience: - Proven background in digital marketing, with specific experience in lead generation campaigns. - Expertise in managing Google and Bing Ads, including a strong understanding of their respective platforms. - Ability to target and tailor advertising content to appeal to an older audience. - Strong analytical skills to interpret campaign data and make ...

    €145 (Avg Bid)
    €145 Oferta mesatare
    35 ofertat

    I am seeking a proficient programmer to develop a scraping application for the purpose of extracting text data from NETFLIX. This project is sensitive, considering that the targeted websites demand API keys for access. Accordingly, the ideal candidate should be familiar with both GET and POST methods as well as API integration and management. Experience with data extraction and web scraping from API authenticated websites is a must. Skill requirements: • Web scraping • HEADERS • CUSTOM HEADEARS • STRINGS • URLLIB • Working knowledge of GET & POST methods • Experience with API authentication • Exceptional skills in data extraction, especially text. • loliscript • SilverBullet i need to get a netflix mass account checker through ...

    €562 (Avg Bid)
    €562 Oferta mesatare
    56 ofertat

    I'm seeking a...endocrine system, its functions, and related nutritional needs - Ability to translate complex scientific information into engaging and easy-to-understand articles - Experience in writing for the general public, with an emphasis on blue-collar workers Your role will be to: - Research and produce articles that address skin issues stemming from Nutritional attributes which effect these glands. - Develop content that is accessible and engaging for a general audience, particularly blue-collar workers - Ensure all content is backed by reliable sources and is accurate in its nutritional advice and information - Run all written articles through CANhaveTODAY Skin Care Inc Content Manager for approval - Take topic assignments from Content Manager - Needs to be residing...

    €50 (Avg Bid)
    €50 Oferta mesatare
    42 ofertat
    Liquid Code Editor in Braze 6 ditë left
    VERIFIKUAR

    I am looking for a skilled developer who can help me develop a custom Liquid code editor to be integrated into the Braze platform. This editor should support custom liquid code snippets. I first need someone to troubleshooting existing code and determine why the color displayed is blue Key Responsibilities: - Troubleshooting existing and building new Liquid code in Braze Ideal Skills and Experience: - Proficiency in Liquid programming language - Experience in developing custom code editors - Prior experience with Braze platform - Proficiency in Syntax: {% if ... %} ... {% elsif ... %} ... {% else %} ... {% endif %}: This is the syntax for conditional statements in Liquid.

    €35 (Avg Bid)
    €35 Oferta mesatare
    13 ofertat
    €56 Oferta mesatare
    3 ofertat

    I'm in need of a professional who is well-versed in WordPress to build a business website for me. The ideal candidate should also have experience with Search Engine Optimization. Key requirements: - Develop a Business Website: A robust and professional business website is needed. It should have a modern design and be user-friendly. - SEO Work: The focus is on improving search engine rankings. The candidate should be able to optimize the website effectively for search engines. Desired skills and experience: - Proven experience in WordPress website development - A strong understanding of SEO principles - Previous work experience with business websites and SEO - Good communication skills and the ability to work collaboratively Please note that I'm particularly intereste...

    €113 (Avg Bid)
    €113 Oferta mesatare
    136 ofertat

    ...experienced with Microsoft Exchange to help me resolve a couple of issues. - The first problem is that I'm experiencing connectivity issues with Outlook. I can't seem to get it to connect properly to the Exchange server. - The second issue is that I'm unable to send or receive emails. This has been causing a great inconvenience and it's important that it gets resolved as soon as possible. I'm using Microsoft Exchange on-premises and the issues are across all versions of Outlook. I'm looking for a freelancer who: - Has previous experience and a solid understanding of Microsoft Exchange on-premises. - Can troubleshoot and resolve connectivity issues with Outlook. - Can address email sending and receiving issues effectively. Pleas...

    €494 (Avg Bid)
    €494 Oferta mesatare
    20 ofertat

    I'm seeking a skilled Solidity developer to create a smart contract on the Ethereum platform for my project. - Proficient in Solidity: Having a deep un...understanding of the Solidity programming language is tremendously important for this project. Familiarity with Ethereum's layer solutions would be advantageous. - Experience with Ethereum: Having significant experience working with smart contracts on the Ethereum platform will be beneficial in ensuring smooth development and functionality implementation. - Types of Projects: We are aiming to develop a smart contract which requires extensive knowledge about writing, testing, and implementing contracts on Ethereum. Prior experience with similar projects is a plus. I look forward to seeing your bids and hearing ab...

    €131 (Avg Bid)
    €131 Oferta mesatare
    23 ofertat

    I'm in need of an experienced .Net developer, with solid skills in MSSQL and C#, who can effectively handle front-end development tasks in my POS terminal project. Your primary tasks will be: - Implement business logic based on defined user stories. - Develop the user interface of the POS terminal using C# and associated .NET technologies. - Integrate the POS terminal with MSSQL database for data storage and management Ideal skills and experience: - Proficiency in .Net, MSSQL, and C#. - Previous experience in front-end development. This role requires both technical expertise and keen attention to detail. I am looking forward to your innovative solutions to meet our project requirements.

    €6 / hr (Avg Bid)
    €6 / hr Oferta mesatare
    38 ofertat
    Glicth App on Swift 6 ditë left
    VERIFIKUAR

    I have an app develop in xcode. This app contains a webview control but when i click in any amazon link my aplication call de app amazon. I need to avoid this.

    €31 (Avg Bid)
    €31 Oferta mesatare
    11 ofertat