Hong kong freelancer vb net punët

Filtër

Kërkimet e mia të fundit
Filtro sipas:
Buxheti
deri në
deri në
deri në
Lloji
Aftёsitё
Gjuhët
    Shteti i punës
    2,000 hong kong freelancer vb net punët e gjetura, me çmimin EUR
    Programing Ka përfunduar left

    Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc

    €11120 (Avg Bid)
    €11120 Oferta mesatare
    4 ofertat
    Crie um Website Ka përfunduar left

    Desenvolvedor .NET MVC, SQL e ADVPL Protheus

    €2700 (Avg Bid)
    €2700 Oferta mesatare
    1 ofertat
    qefqreqweqawdafsc Ka përfunduar left

    asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr

    €182 (Avg Bid)
    €182 Oferta mesatare
    1 ofertat

    với các dụa án đã làm , , , , ...

    €5 / hr (Avg Bid)
    €5 / hr Oferta mesatare
    1 ofertat
    elancer like freelancer Ka përfunduar left

    eqeqe qeqeqeq qeqeqeq qeqeq qeqe

    €0 - €0
    €0 - €0
    0 ofertat

    pershendetje mund te me ndimoni se si te punoj me kete program freelancer se nuk di ta perdor,,,,,ju faleminderit nese mundesh me kthe pergjigje

    €29 (Avg Bid)
    €29 Oferta mesatare
    2 ofertat

    pershendetje mund te me ndimoni se si te punoj me kete program freelancer se nuk di ta perdor,,,,,ju faleminderit nese mundesh me kthe pergjigje

    €138 (Avg Bid)
    €138 Oferta mesatare
    1 ofertat

    Pozdrav susjed... zanima me jel bi radio na mom fiverr accountu i rijesavao narudzbe? Dosad sam ih ja rijesavao bez problema, no jucer i danas imam preko 40 narudzbi, a kako izgleda tako ce se i nastaviti... Ako bude posao isao kao dosad, i ako si ok, mozemo i dalje suradjivat, imam puno poslova za koje trebam freelancera! Posao je jednostavan, no ja ga ne stignem obavljat jer radim web stranicu. Sve ostalo se mozemo dogovorit... Platim ti po satu i bonuse koje se dogovorimo... Vidi, pa se javi!

    €2 / hr (Avg Bid)
    €2 / hr Oferta mesatare
    2 ofertat
    Fiverr Freelancer - Repost Ka përfunduar left

    Pozdrav susjed... zanima me jel bi radio na mom fiverr accountu i rijesavao narudzbe? Dosad sam ih ja rijesavao bez problema, no jucer i danas imam preko 40 narudzbi, a kako izgleda tako ce se i nastaviti... Ako bude posao isao kao dosad, i ako si ok, mozemo i dalje suradjivat, imam puno poslova za koje trebam freelancera! Posao je jednostavan, no ja ga ne stignem obavljat jer radim web stranicu. Sve ostalo se mozemo dogovorit... Platim ti po satu i bonuse koje se dogovorimo... Vidi, pa se javi!

    €2 / hr (Avg Bid)
    €2 / hr Oferta mesatare
    1 ofertat
    yveguwvcjnjnecbkhb Ka përfunduar left

    ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif

    €104 (Avg Bid)
    €104 Oferta mesatare
    1 ofertat

    Hi i Am Looking For Freelancer . To Ad 1 Google AdSense To My Websites.. PLEASE DO GET BACK TO ME I HAVE LOT OF WORK NEED DOING thank you soul

    €9 (Avg Bid)
    €9 Oferta mesatare
    1 ofertat

    As an environmental consultant focusing on natural habitat preservation, I am seeking a competent freelancer to prepare a biodiversity net gain consultancy report. The aim is to formulate effective strategies for enhancing biodiversity within protected natural habitats. Ideal freelancers for this project are: - Qualified environmental scientists or ecologists. Preferably, with a strong understanding of conservation management strategies. - Those with prior experience in drafting biodiversity net gain reports, particularly related to natural habitat preservation. - An understanding of various habitat types would be beneficial, although not essential as the habitat type hasn't been specified in this instance. Key responsibilities: - Evaluate the current state o...

    €63 (Avg Bid)
    €63 Oferta mesatare
    15 ofertat

    I need one Flask developer for some easy tasks now I need work for long term I need work from Pakistan or Indian Coder

    €9 / hr (Avg Bid)
    €9 / hr Oferta mesatare
    11 ofertat

    I'm looking for an experienced freelancer or team to create an all-inclusive home delivery platform that mirrors the functionality of popular platforms like Zomato and Swiggy. The platform should be user-friendly and efficient, catering to both customer and restaurant needs effectively. Key Features: - User Registration and Login: The platform should have a seamless registration and login process for users, ensuring a personalized experience. - Restaurant Search and Listing: A robust search functionality that enables users to easily find and explore various restaurants in their vicinity. - Menu and Item Selection: The platform should support detailed menu listings and an intuitive item selection process for users. Payment System: - The platform should support multiple payment...

    €611 (Avg Bid)
    €611 Oferta mesatare
    18 ofertat

    More details: Is this project for business or personal use? Personal What information should successful freelancers include in their application? Detailed project proposals How soon do you need your project completed? ASAP

    €1004 (Avg Bid)
    €1004 Oferta mesatare
    137 ofertat

    Hello, I hope you are well. My name is Umut Sevinç. I have a project that needs to be done, and I am contacting you for this reason. It will be developed using WPF App (.Net Framework). This is a Real Estate project. The project will include adding, deleting, and updating listings, and will use a database and layered architecture. The listings will be for apartments, villas, and buildings for sale & rent. I do not require a professional-level work; a beginner-level implementation will suffice. Our budget for this project is $50. I would appreciate an immediate response, whether positive or negative. Thank you again, and I hope you have a good day.

    €38 (Avg Bid)
    €38 Oferta mesatare
    13 ofertat

    I'm looking for an experienced Dot Net developer to help me with a bug in my project involving TXTextControl.ServerTextControl. The specific Dot Net component '' is encountering some issues. It's not functioning as expected and I'm looking for someone who can help with bug fixes. The key requirements are: - Experience with Dot Net and TXTextControl.ServerTextControl. - Strong debugging skills to identify the issue. - The ability to implement effective bug fixes.

    €20 (Avg Bid)
    €20 Oferta mesatare
    12 ofertat

    MAX $60 As a business owner, I'm looking for a skilled freelancer to help me transfer an application from my old Windows server to a new one. The server is currently running on Windows OS and the application is built with Visual FoxPro 9 and ASP.NET Key Requirements: - Proficiency in Windows server management and application migration. - Experience with Visual FoxPro 9 and knowledge of its compatibility requirements. The new server must have the following installed: - ASP.NET Framework 3.0 or higher - Visual FoxPro 9 - Office 2019 Please make sure to include in your proposal any related experience and specific skills that make you a suitable candidate for this project. Project Description I'm currently in a bit of a tight spot. A Windows Server 2016 web application...

    €51 (Avg Bid)
    €51 Oferta mesatare
    13 ofertat

    I worked incredibly hard for over a year to bring you a top-notch learning program with Freelancer.com that was never revealed before… It's not just about teaching you everything I know and sharing my journey to the #1 amongst 70 million people; it's also about connecting you with a great community.. Once you complete the program and pass the test, you'll earn an exclusive badge that very few people get.. But.. Also, you get all of the following INCLUDED with NO HIDDEN COST in a YEARLY price of 129 USD: ➡️ Be among the elite few to earn the new IFC badge on your profile so that you can stand out! (Upon successful completion of the test) - Priceless! ➡️ Unlock hours of groundbreaking video content I’ve been working on for months that's nowhere else to b...

    €26 (Avg Bid)
    €26 Oferta mesatare
    1 ofertat

    Tengo un error en codeigner con la api de mikrotik , necesito hacer funcionar este script corrigiendo este error: }catch(Exception $e){ return $e->getMessage(); } } } } // Mi...funcionar este script corrigiendo este error: }catch(Exception $e){ return $e->getMessage(); } } } } // Mikrotik API if (!function_exists('mkClient')) { function mkClient() { return new PEAR2NetRouterOSClient(settings()[0]->mkipadd, settings()[0]->mkuser, settings()[0]->mkpassword); } } // Mikrotik API Util if (!function_exists('mkUtil')) { function mkUtil() { return new PEAR2NetRouterOSUtil(mkClient()); ...

    €29 (Avg Bid)
    €29 Oferta mesatare
    7 ofertat
    Freelancer Developers Needed! -- 5 5 ditë left
    VERIFIKUAR

    Hello! My company, , just launched our updated website and product. It is free to try, but we are looking for paid testers beyond that. I am looking for teams or individuals with some software experience to visit our site and sample our AI powered component UI generator. Please send me your proposal(s) Looking for this to be done as quickly as possible. More user feedback, the better.

    €18 / hr (Avg Bid)
    €18 / hr Oferta mesatare
    70 ofertat

    Hi TOP NOTCH FREELANCER, I noticed your profile and would like to offer you my project. We can discuss any details over chat.

    €9 (Avg Bid)
    €9 Oferta mesatare
    1 ofertat

    I'm in search of a skilled .Net mobile developer to finalize my .Net Maui mobile application. The key tasks include: - Implementing the logic, specifically around user interface interactions. - Although user authentication, data synchronization, and push notifications were not explicitly mentioned, familiarity with these aspects would be advantageous for potential troubleshooting or further development. The mobile application is already well underway, with views, and a nearly finalized backend. Therefore, I need a freelancer who is proficient in both .Net and Maui and can confidently complete the application. Ideal skills and experience: - Proficiency in .Net and Maui - Experience in mobile application development - Understanding of user interface...

    €266 (Avg Bid)
    €266 Oferta mesatare
    23 ofertat

    ...performance improvements. - Regular software updates and security patches. - Feature additions and enhancements. Skills and Experience: - Proven experience in maintaining e-commerce solutions. - Proficiency in React, Node.js, Python, and MySQL. - Strong problem-solving skills. - Excellent understanding of software best practices and design patterns. - Ability to work independently and meet deadlines. - .NET and are a plus but not a requirement. Prerequisites: For the long term project the *STARTING* wage will be as stated below. 1) Accept initial hourly rate of U$5.00 2) If awarded, accept and start work IMMEDIATELY 3) Have MINIMUM OF 20+ hours a week for long term ongoing support and development. 4) Work hours: predominantly 20:00 to 02:00 (UTC -3 Brazil TIME) 5) Be availabl...

    €6 / hr (Avg Bid)
    €6 / hr Oferta mesatare
    56 ofertat

    I worked incredibly hard for over a year to bring you a top-notch learning program with Freelancer.com that was never revealed before… It's not just about teaching you everything I know and sharing my journey to the #1 amongst 70 million people; it's also about connecting you with a great community.. Once you complete the program and pass the test, you'll earn an exclusive badge that very few people get.. But.. Also, you get all of the following INCLUDED with NO HIDDEN COST in a YEARLY price of 129 USD: ➡️ Be among the elite few to earn the new IFC badge on your profile so that you can stand out! (Upon successful completion of the test) - Priceless! ➡️ Unlock hours of groundbreaking video content I’ve been working on for months that's nowhere else to b...

    €26 (Avg Bid)
    €26 Oferta mesatare
    1 ofertat

    I need one Flask developer for some easy tasks now I need work for long term I need work from Pakistan or Indian Coder

    €7 / hr (Avg Bid)
    €7 / hr Oferta mesatare
    17 ofertat

    I am in search of a skilled .NET Core developer to work on a project for me. As the client, I'm looking for someone who can bring the following to the table: - Proficiency in .NET Core: Given that my project is based on this technology, familiarity and experience with it is a must. - Application Development Experience: Previous experience in developing web applications would be particularly beneficial. - Strong Problem-Solving Skills: The ability to troubleshoot issues and devise solutions is key. - Attention to Detail: It's important that our project is implemented correctly and accurately. The ideal candidate for this project would be someone who understands the nuances of .NET Core, has a good track record in application development, and can work efficie...

    €30 (Avg Bid)
    €30 Oferta mesatare
    1 ofertat

    I currently need an experienced industrial designer who can help me perfect a textile net for my product designed for basketball practice. Online, the main task will be to take the prototype of my existing product and make improvements through computing and then send it to be manufactured.

    €123 (Avg Bid)
    €123 Oferta mesatare
    38 ofertat

    I need an experienced data entry freelancer who can assist with a high priority task. The project involves inputting data into an Excel spreadsheet and carrying out online data entry tasks. The ideal candidate will be proactive, detail-oriented, and able to work efficiently with minimal supervision.

    €10 / hr (Avg Bid)
    €10 / hr Oferta mesatare
    64 ofertat

    (solo freelancer que hablen español) (solo freelancer que hablen español) (solo freelancer que hablen español) Estamos buscando una personas que nos configure nuestra plataforma Tutor LMS para wordpress . La idea es que nuestro personal tome cursos internos dictados por la misma empresa. La idea es poder plublicar los cursos con fechas para hacerlos y que nos pueda arrojar el detalle si lo hicieron o no. ademas deberia poder evaluar a cada usuario y luego enviar un reporte de todas las calificaciones por curso. estamos abiertos a utilizar sistemas ya elaborados. contamos con dominio web propio y hosting.

    €50 / hr (Avg Bid)
    €50 / hr Oferta mesatare
    15 ofertat

    I'm in need of a skilled freelancer to assist with some data entry work. While the specifics of the work have not been defined yet, it will likely involve entering data into a database, transcribing written documents into digital format, and/or filling out online forms. The task can involve different formats such as Excel spreadsheets, Word documents, or online platforms.

    €9 (Avg Bid)
    €9 Oferta mesatare
    148 ofertat

    I'm in need of a skilled freelancer to assist with some data entry work. While the specifics of the work have not been defined yet, it will likely involve entering data into a database, transcribing written documents into digital format, and/or filling out online forms. The task can involve different formats such as Excel spreadsheets, Word documents, or online platforms. This job not for India Bangladesh Pakistan and Malaysia

    €10 (Avg Bid)
    €10 Oferta mesatare
    61 ofertat

    Full Stack .NET Core Developer Needed to develop our whats app api platform A basic requirement is that he has previously worked on the WhatsApp API platform. I can review it before starting work

    €234 (Avg Bid)
    €234 Oferta mesatare
    32 ofertat

    I need New freelancer who can create an advanced Productivity app. like Regain screen time + Focus only for Android. The app should have the following features: - All apps Usage - App Reminders: for Example: When the user selects any app for reminder. Let's YouTube as an example. When the user opens Youtube on his phone, a pop- up will appear asking for how long you wants to use youtube. 5 minutes 10 minutes 20 minutes. If the user selects 5 minutes, then a pop-up will appear again if he uses it for 5 minutes. Just like the Regain app. - Separate screen for whatever permission is required. - Bottom Navigation with two button: 1. Home: Show the top app usages time, then selected app open like youtube open 3, Instagram open 5. 2. Apps : Shaw the app list for selecting a...

    €130 (Avg Bid)
    €130 Oferta mesatare
    10 ofertat

    ...1) Linux staging server setup -> deploy our existing project to a new VPS using gitlab 2) Woocommerce -> continue long term development work on our existing custom plugin. Transfer the existing production woocommerce to this staging server. 3) ongoing long term development of our CRM app Other components of our stack which are a HUGE ADDED BENEFIT if you can work on them -> .NET ASP, WEB API + MS SQL DETAILS HERE -> PRIORITY IS TO HAVE A DEVELOPER ON OUR TEAM (LONG TERM) THAT CAN FOR NOW ALSO WORK WEEKENDS AS WE HAVE SEVERAL EMERGENCIES TO FINISH URGENTLY. Someone who can efficiently manage Linux VPS and efficiently use GITLAB is critical. Initially we need part of the hours to be worked in the first weeks from 8:00PM- 2:00am UTC -3 (Brazil Time)

    €8 / hr (Avg Bid)
    €8 / hr Oferta mesatare
    30 ofertat

    ...AS WE HAVE SEVERAL EMERGENCIES TO FINISH URGENTLY. We will start with 5-10 small task in and then go to some smaller .NET tasks all with 1 day sprints for you to become familiar with the software and then our main goal will be to integrate another B2B API for our MVNO. Initially we need part of the hours to be worked in the first weeks from 8:00PM- 2:00am UTC -3 (Brazil Time) later you can work on your time zone. If you are awarded the task we expect you to accept IMMEDIATELY and if the project is not accepted immediatly we will award it to another developer. To qualify you must be full stack and work PROFICIENTLY with gitlab and code in ., .NET ASP, WEB API + MS SQL. We also have woocommerce and have developed and will continue to develop plugins, so PHP and unders...

    €7 / hr (Avg Bid)
    €7 / hr Oferta mesatare
    32 ofertat

    I'm looking for a talented designer who can give my freelancer profile a fresh, creative spin. I want to stand out from the crowd and impress potential clients with a unique and unconventional bio and description. Ideal Skills: - Experience in UX/UI design - Proficiency in copywriting - Creativity and out-of-the-box thinking Key Points: - Your redesign should prioritize improving the user experience on my profile. - The focus will be on revamping the profile bio and description specifically. - The style I'm looking for is creative and unconventional. I want to captivate visitors with something unexpected yet professional. Please showcase your previous work and explain how you'd approach this redesign to help me decide on the best fit for this project.

    €344 (Avg Bid)
    €344 Oferta mesatare
    31 ofertat

    ...skilled freelancer with expertise in LinkedIn optimization, particularly in the sales and these industries. Key requirements and tasks: - Conduct a thorough analysis of my current LinkedIn profile - Optimize the content and layout of the profile to align with my target industries - Enhance the profile to appeal to recruiters in these industries Ideal skills and experience for this job include: - Proven track record in LinkedIn profile optimization, especially for sales positions - In-depth understanding of the fashion, tech, luxury, and hospitality industries - Ability to tailor content to attract recruiters in these specific sectors - Strong communication and collaboration skills to ensure my profile reflects my seniority and expertise in sales. Above all, I'm seeking ...

    €91 (Avg Bid)
    €91 Oferta mesatare
    18 ofertat

    I'm in need of a skilled web builder with expertise in to create a Freelancer directory portfolio. The key functionalities for this Freelancer directory portfolio are as follows: - Advertisement Capabilities: The platform should support advertising placements for users. - Membership Management: Users should be able to sign up, create profiles and manage their memberships on the site. - Profile Content Upload: Users should have the ability to upload their portfolio content on their profiles. Ideal candidate should have: - Proficiency in - Proven experience in developing directory websites, particularly freelancer directories - Strong understanding of advertising and membership functionalities - Ability to enable content upload on user profiles Please don&...

    €258 (Avg Bid)
    €258 Oferta mesatare
    55 ofertat

    I'm looking for a skilled freelancer to develop a customized net worth spreadsheet. This spreadsheet should enable me to meticulously track my financial progress across various categories. Key Requirements: - The spreadsheet should allow me to input and monitor: - Investments (especially individual stocks) - Debt - Savings - Income - Expenses - Other category for miscellaneous expenses or income - I require a simple, user-friendly design that makes manual data entry easy and intuitive. Skills and Experience: - Proficiency in spreadsheet software such as Excel or Google Sheets is essential. - Experience in financial tracking and net worth management is highly beneficial. - Understanding of stock market, investment tracking, and basic accounting pr...

    €56 (Avg Bid)
    €56 Oferta mesatare
    16 ofertat

    I am looking for bidder to grow my fresh profile on Freelancer. Earlier I was working on Fiverr. I have served 600+ clients with 4.9 ratings on Fiverr. Now, I want to grow on this platform. My expertise are graphics designing, photoshop, Ad design, photo editing.

    €80 (Avg Bid)
    €80 Oferta mesatare
    8 ofertat

    I'm in need of a data entry Freelancer who can handle My tasks without specific details. effectively. I have a few files that need to be copied and pasted. While I haven't specified the type of files, the volume is manageable. Let me know your availability and your experience in handling similar projects.

    €9 (Avg Bid)
    €9 Oferta mesatare
    101 ofertat

    Hello, I have my Python/Django site hosted on PythonAnywhere and it's facing a NET::ERR_CERT_DATE_INVALID issue. Website : I would appreciate someone help to troubleshoot this issue and fix the NET::ERR_CERT_DATE_INVALID error, ensuring that the SSL/TLS certificate is correctly set up. - Website troubleshooting and error resolution - SSL/TLS certificate configuration. Thanks in advance !

    €12 / hr (Avg Bid)
    €12 / hr Oferta mesatare
    21 ofertat

    I'm seeking an experienced DevOps engineer who is proficient in deploying React Frontend and .NET Core 8 applications to Alma Linux with NGinx server. The candidate should have solid experience with: - Deploying React FrontEnd and .NET Core 8 Web API applications on Alma Linux in GoDaddy VPS. - Knowledge of routing of both applications with one domain and one SSL. - Knowledge of handling SubDomain. - Knowledge of Alma Linux Nginx deployment. - Understanding of .NET Core Application Settings and React.JS application settings - Understanding of Node.JS

    €52 (Avg Bid)
    €52 Oferta mesatare
    13 ofertat

    I'm seeking an independent ASP.NET developer based in India with at least 5 years of experience, strong C# programming skills, and familiarity with SQL Server and Asp.net core. Your English skills will be crucial as direct communication with me is required. Key Responsibilities: - Develop a robust business management system leveraging ASP.NET - Implement user authentication and authorization features - Integrate appropriate APIs to enhance system functionality Ideal Candidate: - Minimum 5 years experience in ASP.NET development - Proficient in C# programming and SQL Server - Familiarity with Asp.net core - Experience in developing business management systems preferred - Strong communication skills for client call Please note that this project is only open to Indian-based independen...

    €6 / hr (Avg Bid)
    €6 / hr Oferta mesatare
    29 ofertat

    I need a skilled .Net MAUI developer to assist me with my existing project. The main tasks for this project include: - Fixing bugs: The project is currently experiencing some issues which are negatively affecting the user experience. The specific bugs are not provided in this brief, but I can share details during our discussion. - App Publishing: Once the bugs are resolved, you will be responsible for publishing the updated version of the app to both Android and iOS stores. - Delivery of the final source code and making sure it is running on our machine. The ideal freelancer for this project should: - Have a proven track record in debugging and resolving issues in .Net MAUI projects. - Be proficient in the publishing process for both Android and iOS stores and s...

    €178 (Avg Bid)
    €178 Oferta mesatare
    41 ofertat

    I need one new Flask developer for some easy tasks now I need work for long term I need work from Pakistan or Indian Coder

    €6 / hr (Avg Bid)
    €6 / hr Oferta mesatare
    29 ofertat

    Hi, I am looking for the top developer who can develop a auction site with features and customize other necessary features for the frontend & backend. Need to have good sense of UI designing. Requires Live Streaming integration Reference site https://www....looking for the top developer who can develop a auction site with features and customize other necessary features for the frontend & backend. Need to have good sense of UI designing. Requires Live Streaming integration Reference site

    €451 (Avg Bid)
    €451 Oferta mesatare
    163 ofertat

    Ideal Skills and Experience: - Proficient in C# programming language and .NET framework - Experience in developing desktop applications - Familiarity with Visual Studio - Ability to implement data encryption and database integration - Expertise in developing secure user authentication mechanisms Please provide relevant examples of your previous work in C# desktop application development.

    €5 / hr (Avg Bid)
    €5 / hr Oferta mesatare
    27 ofertat

    I need a professional website that aptly portrays my investment advisory services and showcases my portfolio. The website should cater to individual investors, small business owners, and high-net-worth individuals. Key Features: - Detailed and clear information about my advisory services: Candidates with experience in creating informative and engaging content relating to finance or investments will have an advantage. - An investment portfolio section: The ideal freelancer should demonstrate an ability to elegantly display financial data in an accessible manner. - A contact form: Allow visitors to submit inquiries directly through the site. - An investment calculator: This needs to be user-friendly and visually appealing, requiring both frontend and backend capabilities....

    €125 (Avg Bid)
    €125 Oferta mesatare
    21 ofertat