License plate recognition vb net punët
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
I am currently seeking a skilled and experienced C# developer with expertise in the .NET framework. The primary task at hand is to implement advanced background job features within the project, with a specific focus on Asynchronous Processing and Queue Management. Key Deliverables: - Implement Asynchronous Processing: The developer should be able to design and implement a system where tasks can be processed concurrently, allowing for better performance and resource utilization. - Implement Queue Management: The project requires a developer who can set up a robust queue management system, ensuring tasks are executed in the correct order and at the right time. Specific Requirements: - Maximum Queue Size: The system needs to be designed with scalability in mind. You should be able ...
I'm in need of a skilled developer who can build a .NET middle layer for me. This layer will be responsible for calling an external API and handling the responses in a JSON format. The requirement is to design the system in a way that the output is stored in a JSON file. Key Requirements: - Build a .NET middle layer for API calls - Handle API responses in JSON format - Save the output in a JSON file I need this layer to be manually triggered on-demand. This is a crucial aspect of the project, so reliability is key. Ideal Skills: - Proficiency in .NET development - Experience with APIs, especially handling JSON data - Ability to design systems for manual triggers Experience in similar projects is a big plus, so please provide relevant examples in your proposa...
I am looking for ready made chat application built in .net core. Only looking for ready made projects. Features- Edit message, Delete message, Create Group, Status... I need features which is available in google chat.
The Role: We are seeking an Application Developer to join our strong and growing Information Technology group at the California Association of REALTORS® (C.A.R.). This person will work in a team to design, develop, and support mission critical applications. The ideal candidate would be an expert in .NET MVC development using C#, and have experience developing and interfacing with SQL Server databases. The Application Developer creates, maintains, supports, extends and operates computer applications that serve the C.A.R. membership, the general public, and C.A.R. internal staff. The application portfolio is very broad ranging from communication tools to mobile applications, internal data processing applications, database applications, and applications that support our members&r...
I'm looking for a talented Wikipedia editor to create a page on technology for my brand. The main goal of this page is to increase the visibility and recognition of my brand among industry professionals. The ideal candidate should have: - Proven experience in creating high-quality Wikipedia pages - Strong understanding of technology-related topics - Ability to engage and target industry professionals - An eye for detail and accuracy in content If you have experience with creating content that aligns with the guidelines and standards of Wikipedia, and can help increase brand awareness, I'd love to hear from you. Please include samples of your past Wikipedia work in your proposal.
Hi, i am looking for help with a solidwork project. I want to build tuned pipe , expansion chamber for dirt bike. I do know all my dimensions lenght and diameters. I want to be able to draw a line wich will be...every axis along the length required in order to follow the curved and straight section needed. - On that line I want to have adjustable point to be able to adjust length and diameter for each my subsection. Because each pipe is build with many differents cones -Each section/cone needs to be customable on the amount of flat pattern needed. Each flat pettern are to be angle from both edges Steel plate thischness will be 1mm All dimensions are to be outside diameter. I want to be able to enter all my dimensions and length on an excel sheet(edit table) that will be included in ...
Need an android app to generate a pdf document. We have following fields to fill up and also et the end we need to be able to add a signature. - number - date - name - id series -id number - personal identification number - city - address - county - starting date - net income - gross income need to be able to generate pdf and also email option to send directly to email and print option
Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.
As a .NET developer with expertise in multi-tenant functionality, I am in need of a professional who can help me implement and refine this feature within my web application. It involves user authentication, tenant administration, and data isolation. Key Requirements: - Implement a robust user authentication system, ensuring that only authorized users have access to the system. - Develop a seamless tenant administration system, allowing me to manage different tenants within the application. - Ensure data isolation is maintained between tenants, guaranteeing that each tenant's data is secure and isolated from others. - Integrate DNS functionality within the application, allowing me to manage DNS, configure DNS records and resolve DNS queries. Ideal Skills: - Proven experience...
I'm in need of a talented developer who can create an AI-driven web application. This application will be controlled through voice commands, utilizing avatars, and incorporating a chatbot. - The main features of this project are: - Voice Control: T...browsers, ensuring it can be accessed and operated smoothly without the need for a separate mobile application. - The most important aspect of this project is the bidirectional voice conversion functionality. It should seamlessly convert speech to text and vice versa. Ideal Skills and Experience: - Proven experience in developing AI-driven web applications. - Proficiency in voice recognition technology. - Previous work with avatar integration. - Chatbot development skills. - Familiarity with bidirectional vo...
I'm in need of a skilled Python programmer to create a code for an automated student ID card detection system at the entrance of our college ...should be able to specifically identify student ID cards. - The system should be designed to trigger the gate automatically upon detection of an ID card. Alert Notification: - Upon detection, I need the system to provide an intermediate level alert: - ID number - Name - Time of detection Ideal Skills & Experience: - Proficient in Python programming - Experience with image processing and recognition - Previous work with automated systems will be highly beneficial. This project is crucial for our campus security and efficiency. The successful completion of this project could potentially lead to additional automation projects...
I need a seasoned professional with expertise in .Net Core to assist with integrating and retrieving data from the Amazon Selling Partner API. The key tasks for this project will revolve around API integration and product data retrieval. Key Requirements: - Proficiency in .Net Core - Proven experience with API integration - Strong background in product data retrieval - Familiarity with Amazon Selling Partner API would be advantageous The ideal candidate should be able to guide the most effective ways to extract product data from Amazon's API and implement this process seamlessly. I need help of expert on hourly bases with my team. The person who we will hire they need to seat with my team and give solution where we have facing problem. The main problems we are facing ...
Maximum Pay $30 ISSUE: I’m not able to log into my Outlook email account via Windows/Parallels The same Outlook email account works fine on my other devices. SOLUTION: Correct the login issue so that I can log into my Outlook email via Windows/Parallels. Microsoft 365 Email - Login Issue I have a new official Windows 10 license. I have Windows 10 set up via Parallels on my Mac.
I'm seeking a video creator to produce a 1-3 minute promotional video for our esteemed "Postgraduate Diploma in Counselling Psychology" program. The video will target career changers specifically. Key requirements and details: - The video should effectively highlight the program's three main selling points: its course recognition by Singapore Association of Counselling, our experienced faculty, and the hands-on practical training the students receive. - Aim for a balance of engaging visuals, compelling narrative, and informative content that appeals to individuals considering a career shift into counselling psychology. - We'll need the final video to be high-quality and suitable for promotional purposes across various online platforms. The ideal candidate ...
I am looking for a professional digital marketer and web designer who can increase my brand's visibility. The main tasks include: - Develop a brand new website designed to highlight my brand seamlessly - Use key digital marketing strategies to improve brand visibility online (as no existing elements are available for the web design...online (as no existing elements are available for the web design incorporation) Ideal candidates will have: - Experience in creating and maintaining websites - Knowledge in Digital Marketing strategies, particularly in improving brand visibility - Ability to work from scratch since there are no existing brand elements The goal is to create a strong online presence that translates into brand recognition. Please place your bids along with previou...
Currently using .Net Framework 4.5 and looking to upgrade project. The main goal for this upgrade is to ensure compatibility with modern systems. I don't require any specific performance improvements, just upgrading the framework is the main focus. The code base is for a Web API that integrates with SQL Server. There is a separate UI front end that is not included. The current version is .Net Framework 4.5 with the following target techical Stack • ASP.NET Core 8.0 (with .NET 8.0) • ASP.NET WebApi Core • ASP.NET Identity Core • Entity Framework Core • FluentValidation • Swagger UI • GIT Key requirements: - Expertise in C# - Strong understanding of .Net architecture - Previous experience in upgrading .Net projects ...
As an experienced professional with more than a decade in the industry, I'm looking for software/full stack engineers who have a similar level of experience. The main goal of this project is collaboration. Skills Required: - Proficiency in Java, Python, C++, and JavaScript - Expertise in multiple front-end and back-end technologies including React, Angular, Django, Node, Express, and .Net - Excellent communication skills
I'm seeking a skilled social media marketer to undertake a comprehensive campaign across Facebook, Instagram, and Twitter. My primary target audience is teenagers, young adults, adults with children. Do prefer someone in there USA. The main goals of this campaign are to: - Increase brand awareness: I want to enhance my brand's visibility and recognition among my target demographic. - Drive website traffic: The campaign should lead to a noticeable increase in the number of visitors to my website. - Generate leads: Ultimately, the aim is to convert the increased traffic into leads for my business. This project requires a professional with proven experience in social media marketing, particularly with these platforms. Your approach should be creative, ability to help crea...
...handling high-value domain transactions is a must. - You should be well-versed in the intricacies of domain sales, able to identify the right opportunities and negotiate effectively. - Your network and access to premium domain sellers is crucial for a quick turnaround. - While I have not specified the primary goal for this acquisition, a broker who can guide me in aligning the domain with brand recognition, SEO advantage, or a speculative investment would be an added advantage. Timeframe: - This is an urgent requirement and thus, I'm looking for someone who can broker this acquisition for me as soon as possible. - I'm open to offers from brokers with proven track records, even if they come at a premium. Please provide a brief overview of your experience in deali...
Merhabalar elimde PHP bir web sitesi mevcut bu siteden girilen Bilgileri android webvirew ile çekiyorum komlpe sayfayi örneğin Instagram profil resim vb gibi eklemeler yapınca geçerli uygulamaya yonlendirmiyir sadece Türkçe dilini bilen arkadaşlar irtibata gecsin
I am seeking fast-paced professionals to pitch my luxury catering company based in Qatar, targeting high-net-worth individuals, corporate clients, and wedding events. Key Requirements: • Expertise in Marketing Strategies • Familiarity with the catering industry • Understanding of the needs of high-net-worth individuals, corporate, and wedding events Particulars: • My company specializes in International and Middle Eastern fusion cuisine. • Ideally, we generally cater for a maximum of 50 guests per event. Desired Skills: • Excellent communication skills • Previous experience in marketing or catering, specifically within luxury services • Creativity in developing unique, targeted pitches • Understanding of high-end clientel...
I'm in need of a qualified Electrical Engineer, specifically with a PE license to assist with the design of a 20-unit apartment complex of approximately 1500 sf each in Pomona, CA. Ideally, you should have experience in multi-dwelling residential projects. Project requirements include: - Lighting: Design needs to incorporate energy-efficient lighting, dimmable lighting options, and outdoor lighting. - Power outlets: Accurate estimation of the number of outlets per room, inclusion of USB outlets, and GFCI outlets in the design - HVAC System Wiring: Appropriate designs for efficient air conditioning and heating across all units. The project involves 3-4 typical units' designs - each featuring a kitchen, dining area, toilet and 2 bedrooms with bathrooms. Your knowledge of l...
...my users' dashboard to the latest Angular version. The primary focus of this project is to optimize the dashboard's performance through responsive design. Key requirements: - Need to complete user dashboard UI from .NET API to the latest Angular version - Implement a responsive design to enhance load speed and overall performance - Prioritize optimizing charts and data visualization for a better user experience This project will require strong expertise in Angular, particularly in developing responsive designs. The ideal candidate should also have experience working with .NET APIs and be able to effectively optimize data visualization for improved performance. If you have a solid background in these areas and can deliver a high-quality, responsive user dashbo...
We're pulling our focus towards the creation of a logo that will significantly boost our brand recognition. While we've not settled on a specific style, we're leaning more into a design that will resonate with our brand personality and ethos. Key elements are: - Color Scheme: Predominantly Green and Yellow. - Style: Open to innovative ideas; minimalist, retro, or modern. Idea candidates for this project may demonstrate: - Exceptional creativity and originality. - Ability to effectively interpret brand narratives into visual elements. - Proven experience in logo and brand design is necessary. - Knowledge of color psychology and its influences on branding is a plus. - Strong portfolio showcasing a variety of styles and industries. We're excited to see t...
looking for an expert in video analytics to help with a live stream volume calculation project for inventory management. Key Requirements: - Utilizing video analytics to calculate and track volume - Developing a system to process live streaming video feeds - Find volume of a dirt pile using multiple fixed cameras and any other needed sensors in .NET core C#. Examples of apps already built - URC Ventures Stockpile Reports Lite iPhone app; ; Use openly available camera appliances so we shall be independent of any specialty vendors. Please provide testing procedures and testing tools in simulated conditions. If some 3rd party tools are used, our pre-approval, source codes and unlimited licenses be included, meeting
I'm seeking a skilled C# .net developer to improve the performance of my application. - Scope: The project involves fine-tuning the existing codebase, optimizing database queries, and enhancing the overall performance of the application. - Skills: The ideal candidate should have a profound understanding of C# .net development, experience in performance optimization, and a strong grasp of database management. If you're proficient in identifying bottlenecks and implementing solutions to boost system speed and efficiency, I'd like to hear from you. Please share your past relevant experience.
Seeking an innovative graphic designer to bring my sketch to life, envisioning a multi-colored, Ryder Cup inspired logo for a sports event. With time being of the essence, your commitment to promptly delivering high-quality work would indeed be a boon. Key Responsibilities: -...software - Previous experience in logo design - Quick turnaround time - Excellent communication skills Your prompt submission of a well mitigated, polished logo design would be greatly appreciated. As the client, I am keen to collaborate with a dedicated, skillful, and innovative individual to elevate this project from concept to reality. LOGO ELEMENTS. Silver plate with gold handles in the centre. Text as shown. Outside of plate one side with royal blue and gold stars as shown, other half to be I...
...elements: - Bold and vibrant colors: The colors need to be eye-catching and dynamic to make the team stand out on the field. - Abstract patterns: The jersey design should be creative and not just a plain color or basic pattern. I'm looking for something that captures the essence of the game. - Team logo prominently displayed: The team logo should be a focal point of the design, ensuring brand recognition and team spirit. The ideal candidate for this project would have: - Proven experience in designing sports jerseys, preferably for niche sports. - A strong portfolio showcasing abstract, vibrant, and logo-focused designs. - Proficiency in software like Adobe Illustrator or Photoshop to bring the design to life. - Good communication skills to understand and execute my visio...
...sentence at the front of the sentence. "I like popcorn". I'm seeking an AI developer with proficiency in Natural Language Processing and Machine Learning Algorithms to work on a project that primarily involves Image Recognition and Data Analysis. Key Responsibilities: - Develop and implement cutting-edge machine learning models for image recognition. - Create solutions for data analysis utilizing AI technologies. Skills Needed: - Exceptional knowledge in natural language processing and machine learning algorithms. - Proficiency in Python and C++. - Solid understanding of image recognition and data analysis. The ideal candidate will have a proven track record in AI development, particularly in the specified areas, and be able to translate this expe...
I'm looking for someone skilled in both data science and natural language processing (NLP). The tasks at hand involve sentiment analysis, text classification, and named entity recognition. Key Requirements: - Your experience with sentiment analysis should be strong. - You should have a solid background in text classification and be able to manage a medium-sized dataset. - Experience in named entity recognition is essential for this project. Dataset Details: - The dataset you'll be working with is stored in text files. This is a medium-sized dataset, containing between 1,000 and 10,000 data points. The successful completion of this project will require deep expertise in NLP techniques, a keen eye for detail, and the ability to deliver accurate and efficient an...
I'm looking for a proficient ASP .NET MVC developer who can help me create a web application with a specific focus on music streaming. Key functionalities of the project include: * Building the web application from scratch with ASP .NET MVC * Synthesizing a user registration system. It's essential to track user activity for future features, but no user login will be required to access content. * Establishing a data analytics feature. This data should be accessible to admins and will be used to gauge user preferences and activity. * Incorporating real-time notifications. This functionality should alert users of new content, primarily new music uploads. An essential part of this project is the local storage and streaming of music files. These files need to be store...
I'm looking for an experienced ML expert who can help me set up a model for audio analysis. This project is aimed at audio processing, with the goal of predictive analysis, pattern recognition, and potentially fraud detection. Key requirements: - Proficiency in Machine Learning: You should have a strong background in machine learning, particularly in audio analysis. - Experience in Predictive Analysis and Pattern Recognition: The ideal candidate will have experience in both predictive analysis and pattern recognition. - Familiarity with Fraud Detection: While not a must, familiarity with fraud detection would be an advantage for this project. The project duration is estimated to be between 1-3 hours. Please submit your proposal and relevant past experience.
I'm in need of a skilled .Net developer with a strong background in C# programming. The project at hand involves the creation of a web application, specifically a content management system (CMS). Key requirements: - Proficiency in C# programming is essential - Strong grasp of the .Net framework - Experience in developing web applications using ASP.Net MVC - Prior experience with CMS development is highly preferred Your primary responsibility will be to develop a robust, efficient, and user-friendly CMS. This involves creating a system that allows for easy management and modification of digital content. If you have a proven track record in C# development, particularly within the context of web applications and CMS, then I'd be very interested in hearing from yo...
I am in search of an experienced graphic designer to design a logo that exemplifies the essence of my brand. Key Requirements: - Expertise in logo creation - Skill to design in different styles, as we haven't defined a specific one yet - Ability to incorporate the color blue effectively Key Objectives: - Design a visually appealing logo to increase brand recognition - Deliver a crisp and clean design capturing the brand's identity - Adhere to professionalism in design While no specific style is designated, your creativity and innovation are what I'm after. If you have experience designing brand-centric logos, I'd be excited to start this journey with you.
I need a tool that will help me process a large amount of images by cropping them automatically to a landscape format. Project UI Link: to a landscape format. Project UI Link: Key Features: - Image formats supported: JPEG, PNG - Output dimensions: landscape (width > height) - Automatic detection and cropping of the main subject of the image is preferable or that can be selected as need. Ideal Freelancer: - Proficient in image processing and recognition - Experience with automation scripts - Strong background in image data manipulation - Familiarity with JPEG and PNG file formats. If you have the skills and experience necessary to develop such a tool, please get in touch.
As a startup business, I'm seeking a skilled designer to create a visual identity that reflects both professionalism and differentiation from competitors. The design should resonate with a residential audience and incorporate warm and neutral tones. Key requirements: - Create a brand recognition strategy - Develop a professional image - Differentiate my business from competitors Ideal Skills and Experience: - Proficiency in designing for start-up businesses - Capability to work with warm and neutral color palettes - Experience in resonating with a residential demographic - Excellent creativity and design skills Kindly showcase previous work samples reflecting the said criteria. Looking forward to an engaging and professional partnership.
I'm seeking an experienced WordPress developer to craft an e-commerce website primarily using Easy Digital Downloads. Here's what I'm looking for: - Create an intuitive and seamless e-commerce experience. - Integrate Easy Digital Downloads as the core marketplace plugin. - Set up multiple Indian payment gateways, such as Net Banking, BHIM, GPay, and Phone Pay, ensuring security and ease of use. - Optimize site for performance, scalability, and SEO. Ideal Skills: - Proficiency in WordPress & Easy Digital Downloads - Experience with payment gateway integration - Strong portfolio with e-commerce examples - SEO and performance optimization expertise The successful freelancer will demonstrate a strong understanding of e-commerce strategies, particularly within the W...
...and do version control RESPONSIBILITIES: - Integration of new B2B APIs - New payment gateway integration - - Implementation of bug fixes and performance improvements. - Regular software updates and security patches. - Feature additions and enhancements. Skills and Experience: - Proven experience in maintaining e-commerce solutions. - Ability to work independently and meet deadlines. - .NET and are a plus but not a requirement. Prerequisites: For the long term project the *STARTING* wage will be as stated below. 1) Accept initial hourly rate of U$5.00 2) If awarded, accept and start work IMMEDIATELY 3) Have MINIMUM OF 20+ hours a week for long term ongoing support and development. 4) Work hours: predominantly 20:00 to 02:00 (UTC -3 Brazil TIME) 5) Be available to work on wee...
...that function on desktop- and mobile-friendly web pages • Interest in conducting research and learning new things to overcome challenges • Conducting website performance tests • Monitoring the performance of the live website • Experience optimizing web pages and improving page speed • Collaborate with internal teams to produce software design and architecture • Write clean, scalable code using NET programming languages • Test and deploy applications and systems • Revise, update, refactor and debug code • Improve existing software • Serve as an expert on applications and provide technical support • Designing and managing the website back-end including database and server integration • Generating WordPress themes...
...emphasizing on their logos, discounts, and a short text displaying the discount amount. Key Requirements: - 30-second duration: The reel should be concise and engaging, maintaining viewer interest throughout. - Inclusion of video footage: Incorporate clips of the new venues to give users a visual insight into what to expect. - Logos: Each venue's logo should be prominently displayed, ensuring brand recognition. - Discount amount in text: Alongside the video footage, a text overlay displaying the discount amount should be included to amplify the promotional effect. Skills and Experience: - Proven experience in creating engaging promotional reels. - Strong video editing skills and ability to create dynamic sequences. - Proficiency in incorporating logos and text into video c...
Hiring a skilled WordPress Developer for ongoing agency client work. IMPORTANT: - Must be available to work 8 hours per day during US Central Time (Monday to Friday) - All work must be performed on a Windows Remote Desktop which comes with fast internet, strong processor and license to all required tools like Photoshop, code editor etc. The developer will be responsible for daily tasks that include updating web pages, integrating new features into existing WordPress sites, and handling some graphic-related tasks, such as designing and setting up email newsletter templates. Requirements : - Proficiency in WordPress, including themes and plugins - Experience with HTML, CSS, JavaScript, and PHP - Ability to work with graphic design tools such as Adobe Photoshop or Illustrator for b...
I'm in need of an expert logo designer to create a logo that will fulfill three core purposes: 1. Boost brand recognition. 2. Represent my company's values. 3. Attract our target audience. Even though there aren't any specific symbols or images I'd like integrated into the design, I do have a color preference - Brown. The logo will ideally capture and express our brand's uniqueness, reinforcing our identity in the minds of our audience. A successful freelancer for this project would have an impressive portfolio of past logo designs, and fluency in up-to-date design software. Understanding of color psychology in branding would also be an added benefit. I'm looking forward to seeing your creative executions of this brief.
I'm looking for a talented mobile app developer, well-versed in Flutter, to create a cross-platform application. Here are the key aspects of the project: - Compatibility: The mobile app should be compatible with both iOS and Android platforms. - Primary Function: The primary function of the app will be OCR (Optical Character Recognition). This means the app should be able to recognize and extract text from images. - Data Extraction: The OCR function should be specifically designed to extract text from images and past that text in new screen and make search in that text for list of words if it in that text make it highlighted with different screen for user to write list of the text must be translated to user selected there must be user profile and sign and
I have a video of a vehicle involved in an accident, and I need a professional with video manipulation experience to slow down the video and read the license plate. This is required for a police report. Key Responsibilities: - Analyze the video to find the specific frame where the license plate is visible. - Slow down the video effectively for detailed examination. - Accurately decode and transcribe the license plate information. Ideal Candidate: - Proficient in video editing software. - Previous experience in video analysis and enhancement. - Attention to detail and ability to work on a sensitive matter. Need the details of the white pickup that pulls out on the left suddenly.
I'm looking for a professional logo designer to create a logo that will help boost my brand recognition. The logo will be used both online and in print, so it needs to be versatile in terms of its visual appeal and scalability. Key requirements include: - A strong understanding of design principles and branding strategies - Ability to create a unique and memorable logo - Proficiency in graphic design software for both digital and print formats - Experience in designing logos for various platforms I have some preferred colors in mind, so being able to incorporate these into the design is important. Your expertise in color psychology and its application in branding would be a great asset for this project. Please provide a portfolio of your previous logo design work along wit...
...of changes to my existing web application. The application is built on .NET, C#, MVC and MSSQL. The main areas of focus are: - **Database modification(If need)**: - **Adding New Features(If Need)**: I'm looking to integrate some new features into the web application as per requirement. - **Front-End Modifications**: I need some enhancements on the front-end, focusing on design/UI changes as per requirement. Additionally, the project would also involve: - **Back-End Modifications**: These would be required to ensure the new features are implemented effectively. - **Bug Fixes**: Any existing issues within the application should be identified and rectified. The ideal candidate should have extensive experience in .NET, C#, MVC and MSSQL. Additionally, they should ha...
