Locked files vb net punët

Filtër

Kërkimet e mia të fundit
Filtro sipas:
Buxheti
deri në
deri në
deri në
Lloji
Aftёsitё
Gjuhët
    Shteti i punës
    2,000 locked files vb net punët e gjetura, me çmimin EUR
    Programing Ka përfunduar left

    Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc

    €11120 (Avg Bid)
    €11120 Oferta mesatare
    4 ofertat
    Crie um Website Ka përfunduar left

    Desenvolvedor .NET MVC, SQL e ADVPL Protheus

    €2700 (Avg Bid)
    €2700 Oferta mesatare
    1 ofertat
    qefqreqweqawdafsc Ka përfunduar left

    asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr

    €182 (Avg Bid)
    €182 Oferta mesatare
    1 ofertat
    yveguwvcjnjnecbkhb Ka përfunduar left

    ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif

    €104 (Avg Bid)
    €104 Oferta mesatare
    1 ofertat
    Text Copy-Paste from PDF Files 6 ditë left
    VERIFIKUAR

    I have a large batch of text data in PDF files that needs to be copied and pasted into a specific format. Key Requirements: - Transfer text data from various PDF files - Ensure accuracy and precision in the copying - The time-sensitive nature of the task - The data must be transferred into a format that is easy to work with Ideal Candidate: - Proficient in using PDF files - Strong attention to detail - Previous experience with data entry/copy-paste tasks - Ability to work under time constraints

    €10 (Avg Bid)
    €10 Oferta mesatare
    75 ofertat

    I'm in search of a skilled .Net mobile developer to finalize my .Net Maui mobile application. The key tasks include: - Implementing the logic, specifically around user interface interactions. - Although user authentication, data synchronization, and push notifications were not explicitly mentioned, familiarity with these aspects would be advantageous for potential troubleshooting or further development. The mobile application is already well underway, with views, and a nearly finalized backend. Therefore, I need a freelancer who is proficient in both .Net and Maui and can confidently complete the application. Ideal skills and experience: - Proficiency in .Net and Maui - Experience in mobile application development - Understanding of user interface intera...

    €161 (Avg Bid)
    €161 Oferta mesatare
    17 ofertat

    ...performance improvements. - Regular software updates and security patches. - Feature additions and enhancements. Skills and Experience: - Proven experience in maintaining e-commerce solutions. - Proficiency in React, Node.js, Python, and MySQL. - Strong problem-solving skills. - Excellent understanding of software best practices and design patterns. - Ability to work independently and meet deadlines. - .NET and are a plus but not a requirement. Prerequisites: For the long term project the *STARTING* wage will be as stated below. 1) Accept initial hourly rate of U$5.00 2) If awarded, accept and start work IMMEDIATELY 3) Have MINIMUM OF 20+ hours a week for long term ongoing support and development. 4) Work hours: predominantly 20:00 to 02:00 (UTC -3 Brazil TIME) 5) Be availabl...

    €6 / hr (Avg Bid)
    €6 / hr Oferta mesatare
    34 ofertat

    I am in search of a skilled .NET Core developer to work on a project for me. As the client, I'm looking for someone who can bring the following to the table: - Proficiency in .NET Core: Given that my project is based on this technology, familiarity and experience with it is a must. - Application Development Experience: Previous experience in developing web applications would be particularly beneficial. - Strong Problem-Solving Skills: The ability to troubleshoot issues and devise solutions is key. - Attention to Detail: It's important that our project is implemented correctly and accurately. The ideal candidate for this project would be someone who understands the nuances of .NET Core, has a good track record in application development, and can work efficie...

    €30 (Avg Bid)
    €30 Oferta mesatare
    1 ofertat
    Industrial Product Expert Needed 6 ditë left
    VERIFIKUAR

    I currently need an experienced industrial designer who can help me perfect a textile net for my product designed for basketball practice. Online, the main task will be to take the prototype of my existing product and make improvements through computing and then send it to be manufactured.

    €121 (Avg Bid)
    €121 Oferta mesatare
    31 ofertat

    I am in need of someone adept in Excel and knowledgeable in medicine, especially in dosages and weight-based calculations. The challenging aspect of this project is to modify an existing locked Excel spreadsheet which is used to calculate dosages once a patient's weight is entered. Tasks involve: - Updating the dosages of specific medications based on the guidelines I have on hand. - Modifying the weight-based formula in alignment to these dosage updates. Skills and experience: - Proficient in Excel and worksheet protection - Comprehensive understanding of medical dosages - Experience or understanding of weight related dosages calculations. I will provide the necessary medication and dosage guidelines to the successful bidder for reference. The ideal candidate ne...

    €18 / hr (Avg Bid)
    Lokale
    €18 / hr Oferta mesatare
    20 ofertat

    Full Stack .NET Core Developer Needed to develop our whats app api platform A basic requirement is that he has previously worked on the WhatsApp API platform. I can review it before starting work

    €247 (Avg Bid)
    €247 Oferta mesatare
    29 ofertat

    I'm seeking a proficient Corel Draw or adobe Ilustrator user with experience in editing vector graphics for laser cutting purposes. Specifically, I require assistance in modifying shapes and cut paths within these files. Key Responsibilities: - Editing vector graphics for laser cutting - Modifying shapes and cut paths as necessary Ideal Skills and Experience: - Proficient in Corel Draw or Adobe Ilustrator - Experience in editing vector graphics

    €7 / hr (Avg Bid)
    €7 / hr Oferta mesatare
    20 ofertat

    I have a unique project focusing on the creation of 3D OBJ files, which will subsequently be used to develop aesthetically pleasing MP4 video presentations for jewellery pieces. Key Deliverables: - Creation of finely detailed 3D OBJ files for specific jewellery designs. - Conversion of these 3D models into 360-degree rotation MP4 videos showcasing the designs. Ideal Skills: - Proficiency in 3D modelling software to create detailed OBJ files. - Significant experience in video animation/rendering, specifically with jewellery. - A keen eye for detail and a strong aesthetic sense to capture the allure of the jewellery pieces. Your portfolio showcasing previously created 3D models and MP4 videos will be highly appreciated. I believe this project offers an exciting opport...

    €32 (Avg Bid)
    €32 Oferta mesatare
    12 ofertat

    ...1) Linux staging server setup -> deploy our existing project to a new VPS using gitlab 2) Woocommerce -> continue long term development work on our existing custom plugin. Transfer the existing production woocommerce to this staging server. 3) ongoing long term development of our CRM app Other components of our stack which are a HUGE ADDED BENEFIT if you can work on them -> .NET ASP, WEB API + MS SQL DETAILS HERE -> PRIORITY IS TO HAVE A DEVELOPER ON OUR TEAM (LONG TERM) THAT CAN FOR NOW ALSO WORK WEEKENDS AS WE HAVE SEVERAL EMERGENCIES TO FINISH URGENTLY. Someone who can efficiently manage Linux VPS and efficiently use GITLAB is critical. Initially we need part of the hours to be worked in the first weeks from 8:00PM- 2:00am UTC -3 (Brazil Time)

    €8 / hr (Avg Bid)
    €8 / hr Oferta mesatare
    25 ofertat

    ...AS WE HAVE SEVERAL EMERGENCIES TO FINISH URGENTLY. We will start with 5-10 small task in and then go to some smaller .NET tasks all with 1 day sprints for you to become familiar with the software and then our main goal will be to integrate another B2B API for our MVNO. Initially we need part of the hours to be worked in the first weeks from 8:00PM- 2:00am UTC -3 (Brazil Time) later you can work on your time zone. If you are awarded the task we expect you to accept IMMEDIATELY and if the project is not accepted immediatly we will award it to another developer. To qualify you must be full stack and work PROFICIENTLY with gitlab and code in ., .NET ASP, WEB API + MS SQL. We also have woocommerce and have developed and will continue to develop plugins, so PHP and unders...

    €7 / hr (Avg Bid)
    €7 / hr Oferta mesatare
    30 ofertat

    I have a bulk of digital files that need to be accurately transcribed into a digital format. The files are all in English, so proficiency in English is necessary for this project. Ideal skills and experience include: - Proficient in English - Fast and accurate typing skills - Experience with data entry

    €228 (Avg Bid)
    €228 Oferta mesatare
    88 ofertat

    I'm looking for a skilled freelancer to develop a customized net worth spreadsheet. This spreadsheet should enable me to meticulously track my financial progress across various categories. Key Requirements: - The spreadsheet should allow me to input and monitor: - Investments (especially individual stocks) - Debt - Savings - Income - Expenses - Other category for miscellaneous expenses or income - I require a simple, user-friendly design that makes manual data entry easy and intuitive. Skills and Experience: - Proficiency in spreadsheet software such as Excel or Google Sheets is essential. - Experience in financial tracking and net worth management is highly beneficial. - Understanding of stock market, investment tracking, and basic accounting principle...

    €56 (Avg Bid)
    €56 Oferta mesatare
    16 ofertat

    Hello, I have my Python/Django site hosted on PythonAnywhere and it's facing a NET::ERR_CERT_DATE_INVALID issue. Website : I would appreciate someone help to troubleshoot this issue and fix the NET::ERR_CERT_DATE_INVALID error, ensuring that the SSL/TLS certificate is correctly set up. - Website troubleshooting and error resolution - SSL/TLS certificate configuration. Thanks in advance !

    €12 / hr (Avg Bid)
    €12 / hr Oferta mesatare
    21 ofertat

    I'm seeking an experienced DevOps engineer who is proficient in deploying React Frontend and .NET Core 8 applications to Alma Linux with NGinx server. The candidate should have solid experience with: - Deploying React FrontEnd and .NET Core 8 Web API applications on Alma Linux in GoDaddy VPS. - Knowledge of routing of both applications with one domain and one SSL. - Knowledge of handling SubDomain. - Knowledge of Alma Linux Nginx deployment. - Understanding of .NET Core Application Settings and React.JS application settings - Understanding of Node.JS

    €52 (Avg Bid)
    €52 Oferta mesatare
    13 ofertat

    I need a skilled .Net MAUI developer to assist me with my existing project. The main tasks for this project include: - Fixing bugs: The project is currently experiencing some issues which are negatively affecting the user experience. The specific bugs are not provided in this brief, but I can share details during our discussion. - App Publishing: Once the bugs are resolved, you will be responsible for publishing the updated version of the app to both Android and iOS stores. - Delivery of the final source code and making sure it is running on our machine. The ideal freelancer for this project should: - Have a proven track record in debugging and resolving issues in .Net MAUI projects. - Be proficient in the publishing process for both Android and iOS stores and should b...

    €180 (Avg Bid)
    €180 Oferta mesatare
    39 ofertat

    I seek for 20 CAD for the entire project which will be delivered in an hour upon receiving files.

    €13 (Avg Bid)
    €13 Oferta mesatare
    1 ofertat

    I'm in need of a meticulous freelancer who can accurately transfer textual data from digital files into a Word document. Key Requirements: - Proficiency in data entry - Attention to detail to ensure error-free input - Familiarity with Word processing software I will provide the digital files containing the textual data, and I expect the final output to be in a Word document.

    €2 / hr (Avg Bid)
    €2 / hr Oferta mesatare
    86 ofertat

    Hey there! I need a contractor who has access to all the major operating systems: Windows, MacOS, and Linux. For Windows and Linux, virtual machines are acceptable. Another nuance is that you must have an ISO-format keyboard (with a large (tall) Enter key). It includes an additional key with the keycode IntlBackslash, which simply cannot be entered from another keyboard format and thus included in the configurations. The task is fairly simple but voluminous. You will need to add various keyboard layouts to the system and press all the keys in turn on a special web page, which will generate a configuration. List of languages: - English - French - German - Italian - Russian - Ukrainian - Belarusian Each language usually has several layouts in the system. You will need to enter all of th...

    €14 / hr (Avg Bid)
    €14 / hr Oferta mesatare
    23 ofertat

    Ideal Skills and Experience: - Proficient in C# programming language and .NET framework - Experience in developing desktop applications - Familiarity with Visual Studio - Ability to implement data encryption and database integration - Expertise in developing secure user authentication mechanisms Please provide relevant examples of your previous work in C# desktop application development.

    €5 / hr (Avg Bid)
    €5 / hr Oferta mesatare
    25 ofertat

    I need a professional website that aptly portrays my investment advisory services and showcases my portfolio. The website should cater to individual investors, small business owners, and high-net-worth individuals. Key Features: - Detailed and clear information about my advisory services: Candidates with experience in creating informative and engaging content relating to finance or investments will have an advantage. - An investment portfolio section: The ideal freelancer should demonstrate an ability to elegantly display financial data in an accessible manner. - A contact form: Allow visitors to submit inquiries directly through the site. - An investment calculator: This needs to be user-friendly and visually appealing, requiring both frontend and backend capabilities. Ideal...

    €125 (Avg Bid)
    €125 Oferta mesatare
    21 ofertat

    ...accessories field. If you have the creativity and skills to bring fresh ideas and elegant solutions, please send us your portfolio. Let’s create something amazing together! This project involves Arabic-inspired products. Based in Kuwait ?? Thanks Plz read carefully before replying , your 1st understanding of the project will effect my decision..! Attached suggested logo and some references from the net .. regards...

    €194 (Avg Bid)
    €194 Oferta mesatare
    126 ofertat

    I'm l...outreach, and connections to identify suitable candidates. - Running Portfolios: Coordinate the portfolios of these individuals, tracking their performance and making strategic adjustments as needed. - Generating Portfolios via Events: Plan and execute events that attract potential club presidents and generate new portfolios. The ideal candidate should have: - Proven experience in sourcing high-net-worth individuals - An existing network in the business and finance world - Strong project management skills, especially in portfolio management - Excellent communication and negotiation skills This project will be handled collaboratively, so I'm looking for someone who can bring creativity and strategic vision to the table. Please provide details of your relevant expe...

    €18 - €154
    €18 - €154
    0 ofertat

    I have a bulk of digital files that need to be accurately transcribed into a digital format. The files are all in English, so proficiency in English is necessary for this project. Ideal skills and experience include: - Proficient in English - Fast and accurate typing skills - Experience with data entry

    €10 / hr (Avg Bid)
    €10 / hr Oferta mesatare
    135 ofertat

    I'm in need of a professional who can remove FairPlay DRM from an Apple iBook and convert them to ePub format. Key Requirements: - Remove FairPlay DRM: I have only one Apple iBook that are locked by FairPlay DRM. I need these files to be stripped of this DRM while preserving the book content intact. - Conversion to ePub: The final format I require for these files is ePub. The files should maintain their original quality and formatting post conversion. Ideal Skills and Experience: - Prior experience working with FairPlay DRM removal is highly preferred - Proficiency in converting files to ePub format - Attention to detail to ensure that the book content isn't altered during the process Please reach out if you have the necessary skills and exp...

    €17 (Avg Bid)
    €17 Oferta mesatare
    7 ofertat

    I'm looking for a professional who can set up an automatic download of mainly .csv files from FTP, SFTP, https and webscraping-login. The script should be configured to run daily/weekly at pre-defined time - configurable for each file. Requirement: Check after each download that the download has actually been downloaded. Notify user if any errors occur. Key Requirements: - Configure FTP download automation on Windows enviroment or hosted. - Schedule the download to occur at defined day/hour. - Check if download has been succesful. - Clear commented code. I only respond to bids where the bidder clearly has read the description...sorry (not really sorry, lets not waste each others time :) ) I prefer fixed price, but have entered hourly - let me know your suggestion.

    €31 / hr (Avg Bid)
    €31 / hr Oferta mesatare
    66 ofertat

    My project requires an experienced programmer who has the technical abilities to modify an XSL style sheet and adjust its layout. The task will specifically focus on: - Changing the layout of the style sheet and VB code. This modification is needed to appropriately accommodate some new fields that have been added to an import file. - Improving the style sheet so as to automatically map the new fields from the import file. The ideal candidate for this job should have experience with layout adjustments in XSL style sheets, automatic mapping of new fields and VB coding. Your skills and experience in rearranging content layout, updating fonts & colors, and altering data display formats will be highly appreciated. Don't hesitate to place your bid if you can deliver t...

    €129 (Avg Bid)
    Urgjent
    €129 Oferta mesatare
    26 ofertat

    I'm in need of an experienced web developer with strong shell scripting skills. While the main purpose of the website application is not specified, it's targeted at the general public. Ideal Skills and Experience: - Proven expertise in web application development - Experience in creating websites geared towards the general public - Robust skills in shell scripting - Ability to independently make decisions to enhance website functionalities Note: As the tasks for shell scripting are undefined, a flexible way of working is preferred for meeting emergent needs in the project.

    €25 (Avg Bid)
    €25 Oferta mesatare
    23 ofertat

    I'm in urgent need of an illustrative logo designer, who can transform my current logo into high resolution files. This will allow me to effectively use it on tee-shirts, business cards, and even integrate it into a QR code. Key Responsibilities: - Transform the existing logo to an illustrative style - Provide high resolution files in PNG, JPEG, and other relevant formats - Create a design that's suitable for tee-shirts and business cards - Optional: Incorporate the logo into a QR code for business card usage Ideal Skills and Experience: - Proven experience in creating illustrative logos - Proficient in graphic design software for high resolution outputs - Experience in designing for tee-shirts and business cards - Ability to create innovative designs, including ...

    €77 (Avg Bid)
    €77 Oferta mesatare
    121 ofertat

    I have a frontend project built using React and Mobx. The main focus of this project is to clean up the code structure while enhancing the performance of the app. Understanding of .net would be a great plus. Key requirements: 1. **Code Structure Cleanup:** The existing code structure needs to be reorganized and optimized to ensure it's well-maintained and scalable in the future. 2. **Performance Improvement:** The main goal of this cleanup is to enhance the performance of the app. This might involve identifying and removing any redundant code, refactoring certain functions, or optimizing data flow. 3. **Coding Standards:** While there are no strict coding standards in place currently, I'm open to suggestions on implementing best practices. The chosen freelancer should b...

    €433 (Avg Bid)
    €433 Oferta mesatare
    124 ofertat

    I need someone who can deliver me pdf, IGES and STEP files for producing my products on a CNC machine. See attached pdf as an example...

    €14 / hr (Avg Bid)
    €14 / hr Oferta mesatare
    42 ofertat

    I am looking for a proficient C# developer who can build a .Net 8 Console application with in-depth CSV handling capabilities. You will need to be able to: - Import CSV files; - Validate CSV data, specifically focusing on data format and range checks; - Convert validated CSV data to a c# DTO format; - Post the converted data to an API. Responding to errors is a significant part of the project. The application should be able to handle any issues encountered during the import, validation, or conversion processes seamlessly. Proficiency in C# is a core necessity, with previous experience in CSV handling and data validation highly desired.

    €141 (Avg Bid)
    Urgjent
    €141 Oferta mesatare
    36 ofertat

    I'm searching for a highly proficient .NET developer with a strong background in .NET Framework. The scope of this project involves: - Developing a multifaceted data management system for optimal organization and analysis - Creating a robust e-commerce system to drive online sales - Designing a custom application per specified functionality needs The ideal candidate should demonstrate an in-depth understanding of C#, with significant experience applying it within the realm of .NET Framework. Your portfolio should exhibit your versatility in leveraging the .NET Framework for a range of use-cases with a focus on data management, e-commerce solutions, and custom app development.

    €16 / hr (Avg Bid)
    €16 / hr Oferta mesatare
    11 ofertat

    ...award it to another developer. To qualify you must be full stack and conde in . , .NET ASP WEB API + MS SQL Details of our current project STACK can be seen here -> Prerequisites: For this optimization task you can bid your normal hourly rate but for the long term project the starting wage will be as stated below. 1) Accept initial hourly rate of U$5.00 2) Accept and start work immediatly 3) Have MINIMUM OF 20+ hours a week for long term ongoing support and development. 4) If you are awarded the project accept IMMEDIATELY 5) Work hours: predominantly 20:00 to 02:00 (UTC -3 Brazil TIME) 6) Be available to work on weekends. Our projects use: GITLAB -> , ag-grid, C#, .NET API, MS SQL 2017 , WooCommerce digital product sales This is for ongoing long term deve...

    €7 / hr (Avg Bid)
    €7 / hr Oferta mesatare
    48 ofertat

    I need an experienced Maui/Xamarin programmer who can write a native code helper to access(CRUD) the notes field of a selected contact in contacts/phonebook. Primarily for Android bu need to do same on iOS. Therefore programmer needs familiarity with within .net Maui project targetting Android iOs 1) Android code helper 'getnotes(contactid)', returning the notes field of the selected contact Id 'savenotes(contactid,newnote)', posts edited/new notes to notes field of contact Id 2) ditto for iOs Note Maui has an interface to both iOs and Android phoebook/contacts. It does not however offer access to Notes field - therefore this has to be done using native code. In Android my preference is to use a Contentresolver.

    €470 (Avg Bid)
    €470 Oferta mesatare
    37 ofertat

    .NET API to check for misconfiguration in AD CS.

    €460 (Avg Bid)
    €460 Oferta mesatare
    1 ofertat

    I'm seeking a skilled full stack developer to help with a web application project that I'm working on. The ideal candidate should be proficient in JavaScript and .NET, with specific experience in Angular and SQL Server. Key Skills and Experience: - Proficiency in JavaScript and .NET. - Strong knowledge of Angular and SQL Server. - Previous experience in developing web applications. - Ability to work collaboratively in a team setting. Responsibilities: - Develop the front-end using Angular. - Design and maintain the back-end of the application using .NET. - Ensure seamless integration of SQL Server for database management. - Conduct thorough testing to guarantee the application's functionality. This is a great opportunity for a skilled full stack devel...

    €895 (Avg Bid)
    €895 Oferta mesatare
    43 ofertat

    I am seeking a meticulous freelancer experienced in image data entry to input images from my existing digital files into a database system. Skills and Experience: - Comfort and familiarity with transferring images into databases - Keen attention to detail - Ability to handle a sizeable number of digital files - Expertise in working with various database systems Deliverables: - A well structured, neat, and accessible image database compiled from existing digital files. Please ensure images are correctly catalogued and easy to retrieve.

    €230 (Avg Bid)
    €230 Oferta mesatare
    34 ofertat

    I need a .NET software developer to work on a project for me urgently. Key Responsibilities: - Your main task will be software development. I need a professional who can create efficient and high-quality software for my project. Skills & Experience: - Proficiency in ASP.NET, Entity Framework, and Windows Forms is crucial. - Prior experience with similar projects or a portfolio demonstrating your capability in software development would be a bonus. The project is time-sensitive, so I need it completed ASAP. If you're a .NET expert who can hit the ground running on software development, I'd love to hear from you.

    €177 (Avg Bid)
    €177 Oferta mesatare
    84 ofertat
    Dot Net sostware update 4 ditë left
    VERIFIKUAR

    I am currently facing a fairly serious issue with my dot net software - it crashes habitually, specifically when performing a certain function or operation. This has proven to be a major nuisance and has hampered my tasks significantly. Key Objectives: - Discover the root cause of the crashes - Implement a robust and permanent solution to prevent future crashes This project calls for a seasoned dot net developer who has extensive experience with troubleshooting and issue-resolution. Having a strong background in software maintenance and optimization is a definite plus. The ideal candidate will possess: - Experience fixing crash issues with dot net software - Ability to work methodically to identify the source of the issue - Exceptional problem-solving capability ...

    €64 (Avg Bid)
    €64 Oferta mesatare
    5 ofertat
    Intermediate .NET Trainer Required 4 ditë left
    VERIFIKUAR

    I’m looking for an individual with a strong intermediate knowledge level of .NET to conduct training for a small group of 1 to 10 people. Here are the key details about the training to be conducted: - This role requires someone experienced with .NET Core and ASP.NET. Your primary focus will be these areas and you should be able to deliver training effectively on this. - As a trainer, you would need to have an excellent command of these concepts and the ability to explain them in a way that's easy for the participants to understand. - Previous experience with delivering .NET training is a significant plus. 1 day physially training for MIS level audience. location at Bandar Sri Damansara.

    €121 (Avg Bid)
    €121 Oferta mesatare
    15 ofertat

    necesito una app ya sea en VB code o inventor que lea en tiempo real 3 sensores calor corporal, ritmo cardiaco y estres, se necesita lo mas rapido posible.

    €28 (Avg Bid)
    €28 Oferta mesatare
    1 ofertat

    necesito una app ya sea en VB code o inventor que lea en tiempo real 3 sensores calor corporal, ritmo cardiaco y estres, se necesita lo mas rapido posible.

    €399 (Avg Bid)
    €399 Oferta mesatare
    13 ofertat

    ...developer who can work with Visual Basic and/or .NET to create an application with the following requirements: Backend Functionality: - User Authentication: Develop a secure and efficient user authentication system. - Database Integration: Implement a database management system to store and retrieve data. - API Integration: Integrate external APIs to enhance the application’s functionality. Frontend Development: - Develop an intuitive and user-friendly interface for the application. - Ensure that the frontend interacts seamlessly with the backend. Deployment: - Once the development work is complete, you will be responsible for uploading the application to the server of our choice. Ideal Skills and Experience: - Proficiency in Visual Basic and/or .NET - Experience...

    €1013 (Avg Bid)
    €1013 Oferta mesatare
    115 ofertat

    I'm looking for a UI designer to create a user experience that's specifically tailored for high net worth individuals. The project involves designing for both mobile (iOS, Android) and web platforms. Key Project Points: **Enhancing User Experience:** The primary goal of this project is to make navigation and interaction as intuitive and user-friendly as possible for such HNIs. **Multi-Platform Design:** The user interface should be consistent and optimized for both mobile (iOS, Android) and web platforms. Experience in responsive design is a must. For the phase 1, below are the requirements: $$ The application caters to investors / high net worth individuals, who want to invest in startups. Below 3 screens are expected: 1. On the homepage, there will be li...

    €68 (Avg Bid)
    I garantuar
    €68
    13 kandidaturat

    I'm in need of a skilled .Net 8.0 expert to help me fix a Google OAuth issue. The issue lies in the fact that I cannot authenticate users through Google's OAuth system. The primary purpose of this application is user authentication. Ideal candidate for the task should have the following skills and experience: - Proficiency in .NET 8.0 - Extensive experience working with Google OAuth - Strong problem-solving skills - A focus on clean code and system performance - An understanding of user authentication systems. Candidate must have experience with ServiceStack. Please explain what service stack is in the application. Issue needs to be sorted in 48 hours.

    €170 (Avg Bid)
    €170 Oferta mesatare
    23 ofertat