Project requirements vb net punët

Filtër

Kërkimet e mia të fundit
Filtro sipas:
Buxheti
deri në
deri në
deri në
Lloji
Aftёsitё
Gjuhët
    Shteti i punës
    2,000 project requirements vb net punët e gjetura, me çmimin EUR
    Programing Ka përfunduar left

    Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc

    €11139 (Avg Bid)
    €11139 Oferta mesatare
    4 ofertat
    Crie um Website Ka përfunduar left

    Desenvolvedor .NET MVC, SQL e ADVPL Protheus

    €2705 (Avg Bid)
    €2705 Oferta mesatare
    1 ofertat
    qefqreqweqawdafsc Ka përfunduar left

    asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr

    €182 (Avg Bid)
    €182 Oferta mesatare
    1 ofertat
    yveguwvcjnjnecbkhb Ka përfunduar left

    ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif

    €104 (Avg Bid)
    €104 Oferta mesatare
    1 ofertat

    I currently need an experienced online industrial designer who can help me perfect a textile net for my product designed for basketball practice. The main task will be to take the prototype of my existing product and make improvements so that the textile net pushes the balls towards the center of the court. What I want is not a video or a photo, I want computer checks and force studies to verify and test the reliability and probability of what happens when a ball passes through the inside of the funnel with the subsequent purpose of sending it to be manufactured. It will be necessary to provide measurements, material and verifications.

    €104 (Avg Bid)
    €104 Oferta mesatare
    22 ofertat

    I urgently need an expert in C# to integrate my Point of Sale/Enterprise Resource Planning (POS/ERP) system with QuickBooks Online. The goal is seamless syncing of different modules, including, but not limited to: - Customer Information - Inventory Status - Purchase History - Sales Records - Products, Categories, etc... Familiarity with QuickBooks Online APIs and proficiency in C# .net Core is imperative for this role. Past experience with similar projects will be highly valued. The timeline is urgent; I need this integration done ASAP. we already have a code we made integration with SAP Business One, we can share this code to have the fastest development, and also we have the code of a previous developer who made of Quickbooks so it would help to see how to integrate

    €140 (Avg Bid)
    €140 Oferta mesatare
    22 ofertat

    Description: We are seeking a talented web designer to enhance the...and user-friendly interface. - Ensure the design is optimized for both desktop and mobile devices. - Provide design deliverables using Figma or similar tools. Requirements: - Proven experience in web design and UX for e-commerce sites. - Proficiency with Figma or equivalent design software. - Ability to work within platform limitations to deliver a high-quality design. - Strong portfolio showcasing previous design projects. Additional Information: - You will collaborate closely with me (a .NET and React TS developer) to ensure seamless implementation of the design. - Clear and effective communication is crucial for this project. If you have a passion for web design and a keen eye for detail, we&...

    €158 (Avg Bid)
    €158 Oferta mesatare
    105 ofertat

    I have a dataset of images and I'm looking for someone experienced in U-Net algorithm. Project description: - Write PyTorch U-Net training model on top of provided base code (, , , ). - Train the model until achieving a validation dice score of min. 0.875. - Deliver source code and trained model until Wednesday 10 pm (Vietnam time zone).

    €86 (Avg Bid)
    €86 Oferta mesatare
    12 ofertat

    We are urgently looking for a skilled data researcher who will research online UK based local planning authority databases for certain information sets. - Specific focus is needed on planning submissions and permissions that require BNG (biodiversity net gain credits)(the leads). The information is to be taken from Local Planning Authority official websites (publicly available information and no logins required). An in-depth knowledge of planning submissions and permissions and BNG is NOT needed. What is however required is accurate information to be taken from those websites and converted into a database for us. - This work can be done remotely and only requires a computer and access to the internet. - The geographical focus of the UK planning authorities we require information ...

    €29 - €292
    Urgjent I vulosur
    €29 - €292
    12 ofertat

    I'm looking to develop an Android app using .NET MAUI that focuses on facial detection and tracking for attendance monitoring. Key Requirements: - **Facial Detection:** The app should be able to detect faces in real-time. - highlight detected face with rectangle shape - **Server Communication:** Once faces are detected, the app needs to send this information to a server automatically. - **Attendance Tracking:** The primary goal of the app is to leverage this face recognition technology for attendance tracking purposes.(but no need do any page for this now ) Ideal Skills: - Proficient in .NET and MAUI platform for Android development - Strong experience with facial detection and recognition technologies - Prior work on real-time server communication from mobile ...

    €65 (Avg Bid)
    €65 Oferta mesatare
    6 ofertat

    I'm looking for a Microsoft Power Platform expert to help me package and publish a comprehensive PowerApps solution on AppSource. The primary goal for this project is to showcase innovation. Key Components: - Canvas app - Component library - Power Automate flows - Environment variables - Connection references Required Application Information: Freelancers interested in this project should provide a brief description of their relevant experience and knowledge. Ideal Skills and Experience: - Microsoft Power Platform and Dataverse Expertise - C# and .NET Development - Package Deployer Tool Proficiency - Power Apps CLI and Visual Studio Code - Experience with Dynamics 365 SDK - Previous experience in publishing PowerApps solutions on AppSource - Ability to work wi...

    €522 (Avg Bid)
    €522 Oferta mesatare
    31 ofertat
    Dotnet developer 6 ditë left

    Required a dot net developer. Speacialized in Microservices acrhitecture based solution. Dotnet Core, C#, SQL, Data transformation, API gateway, Auth based security.

    €370 (Avg Bid)
    €370 Oferta mesatare
    28 ofertat

    I am looking for an experienced .NET developer who has worked on both web and desktop applications. The ideal candidate should also have a strong background in algo trading and low latency applications. Key Requirements: - Experience with C# and Visual Studio for .NET development. - Previous work on both web and desktop applications. - Proven experience with algo trading. - Prior experience working in low latency applications - React JS work experience is added advantage Skills: - Worked with Websocket, REST APIs - React JS - Ability to understand code written by others and refactor. - Write clean, robust and performant code. Your role will involve: - Building and maintaining robust, high performance applications. - Using your knowledge of algo trading to implement ...

    €1208 (Avg Bid)
    €1208 Oferta mesatare
    37 ofertat

    My project requires the expertise of a freelancer with in-depth knowledge of XBLR accounting. The task is to leverage this skill to generate accurate financial reports for my business, with a specific focus on income statements. Key Responsibilities: - Compile, analyze, and present precise income statements - Ensure the inclusion of gross profit, operating income, and net income in each report. Ideal Freelancer: - Proficient in XBLR accounting - Proven experience in compiling and presenting income statements - Ability to pay attention to detail to ensure accurate financial reporting - Understanding of accounting regulations is highly desired, although not mandatory.

    €36 (Avg Bid)
    €36 Oferta mesatare
    21 ofertat
    Xamarin Migration to .NET 6 ditë left
    VERIFIKUAR

    I am in need of an experienced developer with a strong background in Xamarin. Specifically, I am looking for a professional who can migrate my current Xamarin application to .NET 8. The ideal candidate should be well-versed in: - Xamarin Framework: As the current application is built on Xamarin, the developer must possess a deep understanding of this framework. - .NET 8: I require the application to be migrated to .NET 8. The successful bidder must have a proven track record in migrating applications to this platform. The developer should also be well-versed in the following: - Mobile App Development: Experience in developing and migrating mobile applications is a must - Understanding of E-commerce: As the application serves a business purpose, an understanding of e...

    €444 (Avg Bid)
    €444 Oferta mesatare
    16 ofertat

    Seeking a skilled developer to create a personalized billing software that caters to my business needs. This program should be compatible with the Windows operating system. Must-Have Features: ...accommodate 1-5 users at once, with unique access capabilities for each user. Ideal Candidates: I'm seeking professionals with experience designing and developing business-centric software. Experience with .NET, Java, or other relevant programming languages would be beneficial. Knowledge of Windows-based software development and expertise in back-end databases are essential. Applicants who understand the needs of small-to-mid-sized businesses and have previously developed software within these parameters will be viewed favorably. Ensure your bid reflects your ability to fulfill thes...

    €90 (Avg Bid)
    €90 Oferta mesatare
    19 ofertat

    SEI Membership Club, the leading international company, is home to exceptional high-net-worth individuals who are self-made, often billionaires, entrepreneurs, nobility, high-level professionals, and elite members. The company needs talented artists who are experts in abstract and landscape watercolor and oil paint. We have a preference for the following: - Impressionistic style for the watercolor paintings - Impressionistic style for the oil color paintings - Abstract style for the watercolor paintings - Abstract style for the oil color paintings - Subject matter focused on beautiful landscapes and abstracts The ideal artist would have a strong portfolio that includes landscape paintings, particularly in impressionistic or abstract styles. Experience in both watercolor and oil ...

    €5983 (Avg Bid)
    I cilësuar
    €5983 Oferta mesatare
    24 ofertat

    I am looking for someone to create a custom vehicle repair shop software for me, in VB.NET, Windows Form project, using .NET Framework 8. The full source code must be provided. Attached is the full project requirement

    €2021 (Avg Bid)
    €2021 Oferta mesatare
    34 ofertat

    I need a skilled C# Winform .NET developer to protect my application using obfuscation techniques. The goal is to prevent reverse engineering and ensure the highest level of security. Key Requirements: - Implement Basic name mangling, Control flow obfuscation, and String encryption for the application. Ideal Skills and Experience: - Strong proficiency in C# and .NET framework - Prior experience with implementing obfuscation techniques - Knowledge of application security best practices This project is a great opportunity for a developer with a keen interest in application protection.

    €141 (Avg Bid)
    €141 Oferta mesatare
    26 ofertat

    Please read the brief carefully and Designer Critique is greatly appreciated. Complete, operational, custom web site for drop shipping business. Use whatever language is best suited, we prefer word press (this allows us to do minor modifications inhouse- no programming expertise). Along with the web site, suggest name (search on net and proposed office locations), design logo and compose tagline. All copy by client. Topics covered: Vision, mission, contact, FAQ, terms & Conditions, Returns, Refunds, Shopping from a catalog, Live+Chatbot, order processing, confirmation, tracking, cancellation, payment processing, credit, debit, digital wallets, EFT, (No COD, No Checks)Shipping choices and info, Shopping cart, Days to delivery, Visitor, customer mailing list, Loyalty program, Soc...

    €377 (Avg Bid)
    €377 Oferta mesatare
    43 ofertat

    ...in writing a presentation about chaos engineering and incident management specifically for a .Net driven distributed monolith. Key points include: - The purpose of the presentation is to educate stakeholders and instigate a beneficial scenario discussion, leading us on a path to implementation. - The target audience has an intermediate understanding of chaos engineering and incident management, hence the presentation should be calibrated to this level. - The presentation will heavily emphasize on the practical aspects of chaos engineering and incident management. Focal themes would be implementing chaos engineering, simulating incidents, and strategies for mitigation. To ensure a successful project, you ideally should have: - Past experience and robust understanding of ...

    €14 / hr (Avg Bid)
    €14 / hr Oferta mesatare
    26 ofertat

    We are looking for 5-10 years of .Net experienced developer who can also have experienced in React and .Net based web development. Long terms multiple projects development. Using Mainly Azure SQL server database with Visual Studio .Net Core API. Graph QL and EF. Worked on Azure Key Vault, Azure Logic app, Azure function is bonus.

    €104 (Avg Bid)
    €104 Oferta mesatare
    10 ofertat

    I require an individual proficient in VB macro script for Mach3. This project entails recreating a Mach4 script that particularly focuses on: - Arc motion control - Tool length calculation from spindle holder to tool tip - B/C axis management and position zeroing I have mach4 script that need to be rewriten to mach3 VB language, I have also a video how it works in mach4 fo refernece. You should be able to implement these specifications based on available documentation. Please remember that the recreated script should maintain as much fidelity to the original Mach4 script as possible. Ideal skills and experiences for the job include: - Familiarity with Mach3 and Mach4 CNC software - Expertise in creating VB macro scripts - Understanding of CNC machine opera...

    €135 (Avg Bid)
    €135 Oferta mesatare
    8 ofertat

    I'm in need of an expert in financial modelling to help evaluate numerous real estate investment opportunities. This project is focused on comprehensive analysis of potential investments and to help me make informed decisions. Key Areas: - Evaluating Investment Opportunities: I need someone who can create robust and reliable financial models to assess the viability of various real estate ventures. Your models should help me identify and prioritize the most promising investments. - Financial Metrics: Your models should primarily focus on Return on Investment (ROI), Net Present Value (NPV), and Capitalization Rate (Cap Rate). These are the key metrics I need to see to make sound investment decisions. Ideal Candidate: - Proven Experience: Previous experience in real es...

    €96 (Avg Bid)
    €96 Oferta mesatare
    7 ofertat

    I'm in need of a Flutter Developer to assist with updating our existing Art Prizes app for both iOS and Android. We've made additions to the underlying .NET solution and now require integration of new pages and features. It's crucial that you have a solid understanding of Flutter as well as knowledge on integrating APIs. Previous experience in updating existing apps and implementing push notifications is highly desired. If you don't have a rating of 4.9 or higher I won't be contacting you. You will have a formal process for versioning the iterations and you will have inhouse testing available. If you deliver an initial solution that is full of bugs we won't continue working with you. First deliverable will be the IOS version FOLLOWED by the android ...

    €367 (Avg Bid)
    €367 Oferta mesatare
    72 ofertat

    ...biodiversity net gain consultancy report. The aim is to formulate effective strategies for enhancing biodiversity within protected natural habitats. Ideal freelancers for this project are: - Qualified environmental scientists or ecologists. Preferably, with a strong understanding of conservation management strategies. - Those with prior experience in drafting biodiversity net gain reports, particularly related to natural habitat preservation. - An understanding of various habitat types would be beneficial, although not essential as the habitat type hasn't been specified in this instance. Key responsibilities: - Evaluate the current state of biodiversity within the specified natural habitat areas. - Propose well-researched, achievable strategies for improvi...

    €110 (Avg Bid)
    €110 Oferta mesatare
    25 ofertat

    I'm looking for an experienced ...should support multiple payment options including: - Cash on Delivery - Online Payment (credit/debit card, net banking) - Wallet Payments The ideal candidate/team for this project should have a proven track record in developing similar platforms and should be proficient in backend and frontend development. Strong knowledge of payment gateway integration and security protocols is highly desirable. While the client did not specify a preferred technology stack, your proposal should include your recommended tech stack and the rationale behind it. The client is open to suggestions and is looking for a professional who can guide them through the best options for this project. Please share your portfolio and any relevant...

    €623 (Avg Bid)
    €623 Oferta mesatare
    23 ofertat

    Ebook and formatting for an already illustrated book

    €46 (Avg Bid)
    €46 Oferta mesatare
    1 ofertat

    Hello, I hope you are well. My name is Umut Sevinç. I have a project that needs to be done, and I am contacting you for this reason. It will be developed using WPF App (.Net Framework). This is a Real Estate project. The project will include adding, deleting, and updating listings, and will use a database and layered architecture. The listings will be for apartments, villas, and buildings for sale & rent. I do not require a professional-level work; a beginner-level implementation will suffice. Our budget for this project is $50. I would appreciate an immediate response, whether positive or negative. Thank you again, and I hope you have a good day.

    €41 (Avg Bid)
    €41 Oferta mesatare
    17 ofertat

    I'm looking for an experienced Dot Net developer to help me with a bug in my project involving TXTextControl.ServerTextControl. The specific Dot Net component '' is encountering some issues. It's not functioning as expected and I'm looking for someone who can help with bug fixes. The key requirements are: - Experience with Dot Net and TXTextControl.ServerTextControl. - Strong debugging skills to identify the issue. - The ability to implement effective bug fixes.

    €20 (Avg Bid)
    €20 Oferta mesatare
    15 ofertat

    ...me transfer an application from my old Windows server to a new one. The server is currently running on Windows OS and the application is built with Visual FoxPro 9 and ASP.NET Key Requirements: - Proficiency in Windows server management and application migration. - Experience with Visual FoxPro 9 and knowledge of its compatibility requirements. The new server must have the following installed: - ASP.NET Framework 3.0 or higher - Visual FoxPro 9 - Office 2019 Please make sure to include in your proposal any related experience and specific skills that make you a suitable candidate for this project. Project Description I'm currently in a bit of a tight spot. A Windows Server 2016 web application () was recently moved from a US provider to the by a n...

    €51 (Avg Bid)
    €51 Oferta mesatare
    16 ofertat

    Tengo un error en codeigner con la api de mikrotik , necesito hacer funcionar este script corrigiendo este error: }catch(Exception $e){ return $e->getMessage(); } } } } // Mi...funcionar este script corrigiendo este error: }catch(Exception $e){ return $e->getMessage(); } } } } // Mikrotik API if (!function_exists('mkClient')) { function mkClient() { return new PEAR2NetRouterOSClient(settings()[0]->mkipadd, settings()[0]->mkuser, settings()[0]->mkpassword); } } // Mikrotik API Util if (!function_exists('mkUtil')) { function mkUtil() { return new PEAR2NetRouterOSUtil(mkClient()); ...

    €29 (Avg Bid)
    €29 Oferta mesatare
    7 ofertat

    I'm in search of a skilled .Net mobile developer to finalize my .Net Maui mobile application. The key tasks include: - Implementing the logic, specifically around user interface interactions. - Although user authentication, data synchronization, and push notifications were not explicitly mentioned, familiarity with these aspects would be advantageous for potential troubleshooting or further development. The mobile application is already well underway, with views, and a nearly finalized backend. Therefore, I need a freelancer who is proficient in both .Net and Maui and can confidently complete the application. Ideal skills and experience: - Proficiency in .Net and Maui - Experience in mobile application development - Understanding of user interface intera...

    €271 (Avg Bid)
    €271 Oferta mesatare
    27 ofertat

    ...and security patches. - Feature additions and enhancements. Skills and Experience: - Proven experience in maintaining e-commerce solutions. - Proficiency in React, Node.js, Python, and MySQL. - Strong problem-solving skills. - Excellent understanding of software best practices and design patterns. - Ability to work independently and meet deadlines. - .NET and are a plus but not a requirement. Prerequisites: For the long term project the *STARTING* wage will be as stated below. 1) Accept initial hourly rate of U$5.00 2) If awarded, accept and start work IMMEDIATELY 3) Have MINIMUM OF 20+ hours a week for long term ongoing support and development. 4) Work hours: predominantly 20:00 to 02:00 (UTC -3 Brazil TIME) 5) Be available to work on weekends for the first 2-3 months...

    €6 / hr (Avg Bid)
    €6 / hr Oferta mesatare
    77 ofertat

    I am in search of a skilled .NET Core developer to work on a project for me. As the client, I'm looking for someone who can bring the following to the table: - Proficiency in .NET Core: Given that my project is based on this technology, familiarity and experience with it is a must. - Application Development Experience: Previous experience in developing web applications would be particularly beneficial. - Strong Problem-Solving Skills: The ability to troubleshoot issues and devise solutions is key. - Attention to Detail: It's important that our project is implemented correctly and accurately. The ideal candidate for this project would be someone who understands the nuances of .NET Core, has a good track record in application devel...

    €30 (Avg Bid)
    €30 Oferta mesatare
    1 ofertat

    I currently need an experienced industrial designer who can help me perfect a textile net for my product designed for basketball practice. Online, the main task will be to take the prototype of my existing product and make improvements through computing and then send it to be manufactured.

    €123 (Avg Bid)
    €123 Oferta mesatare
    38 ofertat

    Full Stack .NET Core Developer Needed to develop our whats app api platform A basic requirement is that he has previously worked on the WhatsApp API platform. I can review it before starting work

    €236 (Avg Bid)
    €236 Oferta mesatare
    35 ofertat

    Primary tasks: Initially this is all to be done on a new Linux STAGING ONLY server. 1) Linux staging server setup -> deploy our existing project to a new VPS using gitlab 2) Woocommerce -> continue long term development work on our existing custom plugin. Transfer the existing production woocommerce to this staging server. 3) ongoing long term development of our CRM app 4) gitlab Other components of our stack which are a HUGE ADDED BENEFIT if you can work on them -> .NET ASP, WEB API + MS SQL DETAILS HERE -> PRIORITY IS TO HAVE A DEVELOPER ON OUR TEAM (LONG TERM) THAT CAN FOR NOW ALSO WORK WEEKENDS AS WE HAVE SEVERAL EMERGENCIES TO FINISH URGENTLY. Someone who can efficiently manage Linux VPS and efficiently use GITLAB is critical. Initially we

    €7 / hr (Avg Bid)
    €7 / hr Oferta mesatare
    32 ofertat

    ...QUESTIONS* Details of our current project STACK can be seen here -> PRIORITY IS TO HAVE A DEVELOPER ON OUR TEAM (LONG TERM) THAT CAN FOR NOW ALSO WORK WEEKENDS AS WE HAVE SEVERAL EMERGENCIES TO FINISH URGENTLY. We will start with 5-10 small task in and then go to some smaller .NET tasks all with 1 day sprints for you to become familiar with the software and then our main goal will be to integrate another B2B API for our MVNO. We also have linux server that we would like managed and version control with gitlab also Initially we need part of the hours to be worked in the first weeks from 8:00PM- 2:00am UTC -3 (Brazil Time) later you can work on your time zone. If you are awarded the task we expect you to accept IMMEDIATELY and if the project is not accepte...

    €7 / hr (Avg Bid)
    €7 / hr Oferta mesatare
    32 ofertat

    I'm looking for a skilled freelancer to develop a customized net worth spreadsheet. This spreadsheet should enable me to meticulously track my financial progress across various categories. Key Requirements: - The spreadsheet should allow me to input and monitor: - Investments (especially individual stocks) - Debt - Savings - Income - Expenses - Other category for miscellaneous expenses or income - I require a simple, user-friendly design that makes manual data entry easy and intuitive. Skills and Experience: - Proficiency in spreadsheet software such as Excel or Google Sheets is essential. - Experience in financial tracking and net worth management is highly beneficial. - Understanding of stock market, investment tracking, and basic accounting pr...

    €56 (Avg Bid)
    €56 Oferta mesatare
    16 ofertat

    Hello, I have my Python/Django site hosted on PythonAnywhere and it's facing a NET::ERR_CERT_DATE_INVALID issue. Website : I would appreciate someone help to troubleshoot this issue and fix the NET::ERR_CERT_DATE_INVALID error, ensuring that the SSL/TLS certificate is correctly set up. - Website troubleshooting and error resolution - SSL/TLS certificate configuration. Thanks in advance !

    €12 / hr (Avg Bid)
    €12 / hr Oferta mesatare
    21 ofertat

    I'm seeking an experienced DevOps engineer who is proficient in deploying React Frontend and .NET Core 8 applications to Alma Linux with NGinx server. The candidate should have solid experience with: - Deploying React FrontEnd and .NET Core 8 Web API applications on Alma Linux in GoDaddy VPS. - Knowledge of routing of both applications with one domain and one SSL. - Knowledge of handling SubDomain. - Knowledge of Alma Linux Nginx deployment. - Understanding of .NET Core Application Settings and React.JS application settings - Understanding of Node.JS

    €52 (Avg Bid)
    €52 Oferta mesatare
    13 ofertat

    I'm seeking an adaptable and experienced blockchain developer. Details regarding my specific project requirements, such as needed skills and exact blockchain platform, remain undisclosed at this time. However, be assured that it necessitates a wide range of capabilities within this field. Your understanding of numerous aspects of blockchain technology will be beneficial. - An ability to work autonomously and navigate through varying project details. - Proficiency in smart contract development, cryptocurrency development and blockchain platform integration would be advantageous. - Experience in Ethereum, Hyperledger Fabric, Corda or related platforms is desirable. - Usage of blockchain for various purposes like cryptocurrency, supply chain management, identity ver...

    €2295 (Avg Bid)
    €2295 Oferta mesatare
    36 ofertat

    I need a skilled .Net MAUI developer to assist me with my existing project. The main tasks for this project include: - Fixing bugs: The project is currently experiencing some issues which are negatively affecting the user experience. The specific bugs are not provided in this brief, but I can share details during our discussion. - App Publishing: Once the bugs are resolved, you will be responsible for publishing the updated version of the app to both Android and iOS stores. - Delivery of the final source code and making sure it is running on our machine. The ideal freelancer for this project should: - Have a proven track record in debugging and resolving issues in .Net MAUI projects. - Be proficient in the publishing process for both Android...

    €179 (Avg Bid)
    €179 Oferta mesatare
    39 ofertat

    Ideal Skills and Experience: - Proficient in C# programming language and .NET framework - Experience in developing desktop applications - Familiarity with Visual Studio - Ability to implement data encryption and database integration - Expertise in developing secure user authentication mechanisms Please provide relevant examples of your previous work in C# desktop application development.

    €5 / hr (Avg Bid)
    €5 / hr Oferta mesatare
    27 ofertat

    I need a professional website that aptly portrays my investment advisory services and showcases my portfolio. The website should cater to individual investors, small business owners, and high-net-worth individuals. Key Features: - Detailed and clear information about my advisory services: Candidates with experience in creating informative and engaging content relating to finance or investments will have an advantage. - An investment portfolio section: The ideal freelancer should demonstrate an ability to elegantly display financial data in an accessible manner. - A contact form: Allow visitors to submit inquiries directly through the site. - An investment calculator: This needs to be user-friendly and visually appealing, requiring both frontend and backend capabilities. Ideal...

    €125 (Avg Bid)
    €125 Oferta mesatare
    21 ofertat

    ...We're looking for someone with a strong portfolio in branding and packaging design, especially within the accessories field. If you have the creativity and skills to bring fresh ideas and elegant solutions, please send us your portfolio. Let’s create something amazing together! This project involves Arabic-inspired products. Based in Kuwait ?? Thanks Plz read carefully before replying , your 1st understanding of the project will effect my decision..! Attached suggested logo and some references from the net .. regards...

    €195 (Avg Bid)
    €195 Oferta mesatare
    131 ofertat

    ...high-end individuals for a unique project. Key responsibilities: - Sourcing Billionaire Club Presidents: Utilize professional networking sites, exclusive events, direct outreach, and connections to identify suitable candidates. - Running Portfolios: Coordinate the portfolios of these individuals, tracking their performance and making strategic adjustments as needed. - Generating Portfolios via Events: Plan and execute events that attract potential club presidents and generate new portfolios. The ideal candidate should have: - Proven experience in sourcing high-net-worth individuals - An existing network in the business and finance world - Strong project management skills, especially in portfolio management - Excellent communication and negotiation skills This ...

    €18 - €154
    €18 - €154
    0 ofertat

    My project requires an experienced programmer who has the technical abilities to modify an XSL style sheet and adjust its layout. The task will specifically focus on: - Changing the layout of the style sheet and VB code. This modification is needed to appropriately accommodate some new fields that have been added to an import file. - Improving the style sheet so as to automatically map the new fields from the import file. The ideal candidate for this job should have experience with layout adjustments in XSL style sheets, automatic mapping of new fields and VB coding. Your skills and experience in rearranging content layout, updating fonts & colors, and altering data display formats will be highly appreciated. Don't hesitate to place your bid if you can de...

    €129 (Avg Bid)
    Urgjent
    €129 Oferta mesatare
    26 ofertat

    I'm in need of an experienced web developer with strong shell scripting skills. While the main purpose of the website application is not specified, it's targeted at the general public. Ideal Skills and Experience: - Proven expertise in web application development - Experience in creating websites geared towards the general public - Robust skills in shell scripting - Ability to independently...public. Ideal Skills and Experience: - Proven expertise in web application development - Experience in creating websites geared towards the general public - Robust skills in shell scripting - Ability to independently make decisions to enhance website functionalities Note: As the tasks for shell scripting are undefined, a flexible way of working is preferred for meeting emergent needs in...

    €25 (Avg Bid)
    €25 Oferta mesatare
    23 ofertat