Vb net webbrowser scraping punët
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.
SEI Membership Club, the leading international company, is home to exceptional high-net-worth individuals who are self-made, often billionaires, entrepreneurs, nobility, high-level professionals, and elite members. The company needs talented artists who are abstract and landscape watercolor and oil paint experts
Job Title: Full-Stack Developer for WordPress, .NET Middleware, Azure Integration, and SDK Development Job Overview: We are seeking an experienced Full-Stack Developer to spearhead the development and integration of key system components within our e-commerce platform. The successful candidate will lead initiatives to enhance user interactions by developing a WordPress plugin, building a robust .NET middleware API, and integrating advanced Azure-based messaging services. Additionally, the role involves creating an SDK to facilitate easy integration for third-party AI bot services. This position is crucial for ensuring that our platform not only meets current technological standards but also adapts to future advancements and user needs, enhancing both the scalability and func...
I'm looking for an expert who can put together a precise and comprehensive multifamily proforma that focuses on cash flow details. Specifics Required: - Include data on net operating income, debt service, and cash on cash return. - An in-depth monthly breakdown of these values. Skills & Experience: - Proven track record in financial analysis, specifically real estate and multifamily property market. - Professional approach with strong attention to detail. - High-level proficiency in using proforma software or Excel. - Understanding of the specifics of rental property cash flows.
...skilled and experienced Data Scraping Specialist to optimize and significantly increase the speed of our current data scraping processes. The ideal candidate will have extensive experience in web scraping, advanced knowledge of bypassing anti-scraping measures, and proficiency in utilizing cloud-based solutions for enhanced performance. Strong problem-solving and hacking skills to navigate complex web security systems are essential for this role. Responsibilities: Analyze and improve existing data scraping scripts to maximize efficiency and speed. Implement and manage cloud-based solutions (AWS, GCP, Azure, etc.) for scalable scraping tasks. Develop advanced strategies to bypass anti-scraping measures like CAPTCHAs, rate limiting, and I...
I'm looking for a skilled freelancer with prior experience in data scraping to help me extract specific text content and URLs from a public site. Key Details: - Your main task will be to collect the text content and URLs from the site. - Previous experience in a similar project is a must. - Please provide me with details regarding your experience in your application. The purpose of this data scraping project is for market analysis.
I currently need an experienced online industrial designer who can help me perfect a textile net for my product designed for basketball practice. The main task will be to take the prototype of my existing product and make improvements so that the textile net pushes the balls towards the center of the court. What I want is not a video or a photo, I want computer checks and force studies to verify and test the reliability and probability of what happens when a ball passes through the inside of the funnel with the subsequent purpose of sending it to be manufactured. It will be necessary to provide measurements, material and verifications.
I'm looking for a data scraping specialist proficient in leveraging social media platforms, business directories and website scraping. The goal is to create an Excel sheet with approximately 500 entries for market research purposes. Skills & Requirements: - Proficient in data scraping from multiple sources - Capable of filtering and sorting data - Able to extract and compile the following data fields: zip codes, locations, contact information, business name and industry. The successful candidate should demonstrate experience in similar projects, showcasing their ability to find and compile information efficiently and accurately for market research purposes.
I'm looking for an e...House website or through a manually updated database. Key Features: - Development for both iOS and Android platforms - Implementation of user notification features including push notifications, email alerts, and SMS alerts. Ideal Skills and Experience: - Proven track record in developing and launching user-friendly mobile applications for both iOS and Android - Familiarity with APIs and web scraping to acquire real-time data from government websites or the ability to create a reliable, manually updated database - Experience in integrating push notifications, email alerts, and SMS alerts into a mobile application Please note that this project may involve a degree of flexibility, as the method for acquiring flag status information has not been definitive...
I need a comprehensive web scraping task done on Yellowpages for business broker. The goal is to extract the following data about businesses: - Business name - Address - Phone number - Email - Website - Contact Person I'm looking for a professional who is well-versed in web scraping and can deliver accurate and complete data. Skills required: - Proficiency in web scraping techniques - Experience with scraping - Attention to detail to ensure all relevant data is captured - Ability to deliver in a timely manner Please note that the number of pages to be scraped is not defined, meaning the task might involve a large number of results. The scraper should be able to handle this efficiently.
I've got a list of company names on an Excel sheet that I need you to help me with. Here's how you can assist: - **Scraping from Multiple Platforms**: I need you to scrape email addresses, phone numbers, and any available social media accounts of these companies. You'll need to do this across Yelp, Google Maps, and TripAdvisor. - **Social Media Scraping**: In addition to the primary two platforms (Instagram and Twitter), I'll also need you to scrape Facebook accounts if available. Ideal candidates for this project should have: - **Web Scraping Experience**: A good knowledge of web scraping techniques and tools, which will ensure you can obtain accurate and reliable data. - **Data Mining Knowledge**: The ability to identify and extract the ...
I'm looking for a freelancer to help me extract financial data and regulatory filings from a tax website. This involves scrapping website using the provided credentials by the client...300 data points extracted. - The output for these data points should be organized into a PDF or Word. This project is about creating an automated system to generate instant reports about a company. Only difficulty is the website has drops downs to select the period involved and in those 300 data points actually many come from the same source. Ideal Skills and Experience: - Experience in web scraping (Python) - Proficient in creating PDF documents from extracted data - Adept at handling large amounts of data - Familiarity with tax websites would be a plus but is not neccesary because it will cl...
I urgently need an expert in C# to integrate my Point of Sale/Enterprise Resource Planning (POS/ERP) system with QuickBooks Online. The goal is seamless syncing of different modules, including, but not limited to: - Customer Information - Inventory Status - Purchase History - Sales Records - Products, Categories, etc... Familiarity with QuickBooks Online APIs and proficiency in C# .net Core is imperative for this role. Past experience with similar projects will be highly valued. The timeline is urgent; I need this integration done ASAP. we already have a code we made integration with SAP Business One, we can share this code to have the fastest development, and also we have the code of a previous developer who made of Quickbooks so it would help to see how to integrate
Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.
Description: We are seeking a talented web designer to enhance the design and user experience (UX) of our car audio dealers' e-commerce website. Our current platform h...Provide design deliverables using Figma or similar tools. Requirements: - Proven experience in web design and UX for e-commerce sites. - Proficiency with Figma or equivalent design software. - Ability to work within platform limitations to deliver a high-quality design. - Strong portfolio showcasing previous design projects. Additional Information: - You will collaborate closely with me (a .NET and React TS developer) to ensure seamless implementation of the design. - Clear and effective communication is crucial for this project. If you have a passion for web design and a keen eye for detail, we'd lo...
I need a freelancer with web scraping skills who can extract product prices and models from my 17 competitors. Ideally, the freelancer should be able to: Extract information accurately and comprehensively. Upload all the extracted information into an Excel sheet. Create a simple online website to facilitate this process. I have hosting and a domain. Enable me to update the extracted information with a single click. Complete this task within a maximum of 48 hours. Please include detailed proposals in your application on how you would approach this project.
I have a dataset of images and I'm looking for someone experienced in U-Net algorithm. Project description: - Write PyTorch U-Net training model on top of provided base code (, , , ). - Train the model until achieving a validation dice score of min. 0.875. - Deliver source code and trained model until Wednesday 10 pm (Vietnam time zone).
We are urgently looking for a skilled data researcher who will research online UK based local planning authority databases for certain information sets. - Specific focus is needed on planning submissions and permissions that require BNG (biodiversity net gain credits)(the leads). The information is to be taken from Local Planning Authority official websites (publicly available information and no logins required). An in-depth knowledge of planning submissions and permissions and BNG is NOT needed. What is however required is accurate information to be taken from those websites and converted into a database for us. - This work can be done remotely and only requires a computer and access to the internet. - The geographical focus of the UK planning authorities we require information ...
I'm looking to develop an Android app using .NET MAUI that focuses on facial detection and tracking for attendance monitoring. Key Requirements: - **Facial Detection:** The app should be able to detect faces in real-time. - highlight detected face with rectangle shape - **Server Communication:** Once faces are detected, the app needs to send this information to a server automatically. - **Attendance Tracking:** The primary goal of the app is to leverage this face recognition technology for attendance tracking purposes.(but no need do any page for this now ) Ideal Skills: - Proficient in .NET and MAUI platform for Android development - Strong experience with facial detection and recognition technologies - Prior work on real-time server communication from mobile apps - ...
I need a Java or python3 programmer to create a sensor-data g...Key Requirements: - Create a sensor-data generator in Java or python3 - The generator should simulate mouse movements, keyboard interactions, and browser interactions - The sensor-data should be valid enough to trigger the generation of the _abck cookie upon sending a POST request to Ideal Skills and Experience: - Proficiency in Java/python3 programming - Experience in web scraping and automation - Knowledge of cookies and their generation - Experience in simulating sensor data such as mouse movements and keyboard interactions Please note, the success of this project is heavily dependent on the ability to accurately simulate sensor data and trigger the generation of the _abck cookie on the specified website.
...project is to showcase innovation. Key Components: - Canvas app - Component library - Power Automate flows - Environment variables - Connection references Required Application Information: Freelancers interested in this project should provide a brief description of their relevant experience and knowledge. Ideal Skills and Experience: - Microsoft Power Platform and Dataverse Expertise - C# and .NET Development - Package Deployer Tool Proficiency - Power Apps CLI and Visual Studio Code - Experience with Dynamics 365 SDK - Previous experience in publishing PowerApps solutions on AppSource - Ability to work with canvas apps, component libraries, Power Automate flows, environment variables, and connection references - Strong problem-solving skills - Good understanding of the App...
Looking for help in modifying an existing python script and related sql database table The current script - (1) scrapes company financial data from website and populates database (2) scrapes news related to keywords from google news (3)sentiment classification of news items (4)pushes data to sql database The company names and keywords are currently hardcoded in the script Requirement- (1) Company names/urls/keywords (will be provided) to be put in master table in the database (2) The script to loop through and scrape the relevant data and put in database
I'm looking for a freelancer who's great at web scraping to help with a project involving a specific website initially, with potential for more. I'll give you the specific data fields to extract. It'd be great if you: Are really good at web scraping and or Python. Know your way around MS SQL Server databases, not essential but definately an advantage. Understand how to extract data effectively. Understand the need for security and captcha integration if needed. Can work quickly since this project is a priority and needs to be done ASAP. Ultimately, I want to be able to manage the code with your ongoing help, so this could lead to a long-term partnership. I'll share the full details when needed. You will provide source code, documentation and deployme...
Required a dot net developer. Speacialized in Microservices acrhitecture based solution. Dotnet Core, C#, SQL, Data transformation, API gateway, Auth based security.
I am looking for an experienced .NET developer who has worked on both web and desktop applications. The ideal candidate should also have a strong background in algo trading and low latency applications. Key Requirements: - Experience with C# and Visual Studio for .NET development. - Previous work on both web and desktop applications. - Proven experience with algo trading. - Prior experience working in low latency applications - React JS work experience is added advantage Skills: - Worked with Websocket, REST APIs - React JS - Ability to understand code written by others and refactor. - Write clean, robust and performant code. Your role will involve: - Building and maintaining robust, high performance applications. - Using your knowledge of algo trading to implement and opt...
I'm in need of a concert ticket bot that can operate on several platforms, including Ticketmaster, Live Nation, ThaiTicketMajor, and BookMyShow Malaysia. The ideal bot should be able to perform sev...solving techniques or third-party captcha services if there is any available captcha yet to be solve, ensure scalability to handle high request volumes - Session tracking : the bot should extract and log the link for any session that successfully passes the queue The bot should be smart enough to navigate through the ticketing process of these platforms and complete the purchase. Experience in web scraping, automation, and ticketing bots, as well as knowledge of the mentioned platforms, is a must. If you can build a robust, reliable bot that meets these requirements, I'd lo...
My project requires the expertise of a freelancer with in-depth knowledge of XBLR accounting. The task is to leverage this skill to generate accurate financial reports for my business, with a specific focus on income statements. Key Responsibilities: - Compile, analyze, and present precise income statements - Ensure the inclusion of gross profit, operating income, and net income in each report. Ideal Freelancer: - Proficient in XBLR accounting - Proven experience in compiling and presenting income statements - Ability to pay attention to detail to ensure accurate financial reporting - Understanding of accounting regulations is highly desired, although not mandatory.
...expert, specializing in web scraping. I require someone who can proficiently extract data from various websites. The specifics of the data may vary from text content, images, links, to contact information. Your key responsibilities will include: - Writing effective and efficient Python scripts to scrape data - Ensuring the data is extracted accurately and in a structured format - Delivering the data in a timely manner The ideal candidate should have: - Proficient experience in Python and web scraping - A strong understanding of data extraction techniques - Proven experience in handling and parsing a variety of data types - Excellent communication skills and the ability to meet deadlines Please be prepared to provide examples of your previous work in web scraping...
I am in need of an experienced developer with a strong background in Xamarin. Specifically, I am looking for a professional who can migrate my current Xamarin application to .NET 8. The ideal candidate should be well-versed in: - Xamarin Framework: As the current application is built on Xamarin, the developer must possess a deep understanding of this framework. - .NET 8: I require the application to be migrated to .NET 8. The successful bidder must have a proven track record in migrating applications to this platform. The developer should also be well-versed in the following: - Mobile App Development: Experience in developing and migrating mobile applications is a must - Understanding of E-commerce: As the application serves a business purpose, an understanding of e...
I'm looking for an experienced hacker who specializes in database scraping to assist with lead generation. My main aim is to get detailed contacts to grow my business. - Specific Tasks: - Database scraping - Extract contact details - Contact Information: - Email addresses - Phone numbers Ideal candidates should have previous experience in the field. Proficiency in data mining and scraping is a must, along with an understanding of lead generation strategies. Strong grips and successful track records on obtaining accurate contact details are key to perform this job efficiently.
...personalized customer experiences is crucial. - Sales Reporting: We require comprehensive sales reports to review our business's progress and areas for improvement. Users: The software should easily accommodate 1-5 users at once, with unique access capabilities for each user. Ideal Candidates: I'm seeking professionals with experience designing and developing business-centric software. Experience with .NET, Java, or other relevant programming languages would be beneficial. Knowledge of Windows-based software development and expertise in back-end databases are essential. Applicants who understand the needs of small-to-mid-sized businesses and have previously developed software within these parameters will be viewed favorably. Ensure your bid reflects your ability to ...
I'm looking for an experienced developer to help with real-time text data scraping via API and management using BeautifulSoup. This project is primarily focused on retrieving text data and storing it in a database. Key Responsibilities: - Implement an API scraper to continuously retrieve text data in real-time - Utilize BeautifulSoup for data extraction and management - Develop a robust database to store all the scraped text data The ideal candidate should have: - Proficiency in Python programming language - Strong experience with API scraping and BeautifulSoup - Previous work involving real-time data scraping - A good understanding of database management It is important that the data scraping runs seamlessly and accurately in real-time. Prior experien...
SEI Membership Club, the leading international company, is home to exceptional high-net-worth individuals who are self-made, often billionaires, entrepreneurs, nobility, high-level professionals, and elite members. The company needs talented artists who are experts in abstract and landscape watercolor and oil paint. We have a preference for the following: - Impressionistic style for the watercolor paintings - Impressionistic style for the oil color paintings - Abstract style for the watercolor paintings - Abstract style for the oil color paintings - Subject matter focused on beautiful landscapes and abstracts The ideal artist would have a strong portfolio that includes landscape paintings, particularly in impressionistic or abstract styles. Experience in both watercolor and oil ...
I am looking for someone to create a custom vehicle repair shop software for me, in VB.NET, Windows Form project, using .NET Framework 8. The full source code must be provided. Attached is the full project requirement
Introduction We are seeking proposals from experienced web scraping and data analysis firms to conduct a comprehensive data collection and analysis project. The purpose of this project is to gather detailed information on menu items, pricing, customer ratings, promotions, and deals from various food delivery mobile apps operating within our city. The goal is to mine this data for actionable insights to inform our advertising, promotional strategies, and competitive benchmarking. 2. Project Scope The selected vendor will be responsible for developing and implementing a solution to: • Subscribe to and navigate through multiple food delivery mobile apps. • Collect data on menu items including descriptions, pricing, customer ratings, and associated promotions or deals. •...
...information and disease descriptions. Requirements: Programming Language: Preferably Python. Libraries: Experience with web scraping libraries like BeautifulSoup, Selenium, and data processing libraries like Pandas. Output Format: Ability to export data into an Excel file using Pandas or similar libraries. Error Handling: Robust error handling to manage failed requests and parsing errors. Compliance: Adherence to the websites' terms of service and rate limits to avoid being blocked. Project Scope: Input: A list of CRM numbers and a list of CID numbers. Process: Automate the lookup and data extraction process. Output: An Excel file with the compiled data. Skills Required: Web Scraping Python Programming Data Processing Automation Excel File Generation To Apply: Plea...
... person within each company. This could be anywhere between 10 to 30 people per company. - The information should be accurate and up to date. - If you have a strategy for obtaining this data, please share it in your bid. Skills/Experience: - Strong research skills - Data entry and data mining expertise - Proficient in Saudi Arabian business landscape - Attention to detail and accuracy - Web scraping - Web search - Leads Results should be in an excel sheet format, outlining the name, position, email address for each contact. Contacts for each company should be grouped together, end file should be in 1 sheet, not separate sheets. Send me: 1- Your strategy in finding those companies and collecting names and emails of relevant employees, 2- Total number of expected VERIFIED leads...
I need a skilled C# Winform .NET developer to protect my application using obfuscation techniques. The goal is to prevent reverse engineering and ensure the highest level of security. Key Requirements: - Implement Basic name mangling, Control flow obfuscation, and String encryption for the application. Ideal Skills and Experience: - Strong proficiency in C# and .NET framework - Prior experience with implementing obfuscation techniques - Knowledge of application security best practices This project is a great opportunity for a developer with a keen interest in application protection.
Please read the brief carefully and Designer Critique is greatly appreciated. Complete, operational, custom web site for drop shipping business. Use whatever language is best suited, we prefer word press (this allows us to do minor modifications inhouse- no programming expertise). Along with the web site, suggest name (search on net and proposed office locations), design logo and compose tagline. All copy by client. Topics covered: Vision, mission, contact, FAQ, terms & Conditions, Returns, Refunds, Shopping from a catalog, Live+Chatbot, order processing, confirmation, tracking, cancellation, payment processing, credit, debit, digital wallets, EFT, (No COD, No Checks)Shipping choices and info, Shopping cart, Days to delivery, Visitor, customer mailing list, Loyalty program, Soc...
Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.
I am on a quest for an exceptional individual who can collaborate with me in writing a presentation about chaos engineering and incident management specifically for a .Net driven distributed monolith. Key points include: - The purpose of the presentation is to educate stakeholders and instigate a beneficial scenario discussion, leading us on a path to implementation. - The target audience has an intermediate understanding of chaos engineering and incident management, hence the presentation should be calibrated to this level. - The presentation will heavily emphasize on the practical aspects of chaos engineering and incident management. Focal themes would be implementing chaos engineering, simulating incidents, and strategies for mitigation. To ensure a successful project, you ide...
I need a professional to scrape names and email addresses from specific public websites. I'm looking to populate a database with details from a range of public websites. This data will be used for lead generation and market research purposes. Ideal skills and experience: - Proficient in web scraping - Familiar with public data extraction - Able to structure data effectively
We are looking for 5-10 years of .Net experienced developer who can also have experienced in React and .Net based web development. Long terms multiple projects development. Using Mainly Azure SQL server database with Visual Studio .Net Core API. Graph QL and EF. Worked on Azure Key Vault, Azure Logic app, Azure function is bonus.
I need to Extract followers of group members of the link I will provide
I am looking for a web-scraping expert to retrieve both images and text from a specific website for research purposes. The text data will need to be structured and saved in a CSV file, including paths to saved images. Key details to consider: - Knowledge of web scraping tools and techniques is essential to accomplish this task. - Quality control to ensure accurate data extraction and image quality is critical. - Structure page information and freeform descriptions should be made available in a CSV file. - The images should be saved in their original resolution and quality settings. Please provide any relevant experience you have in web scraping, including free and paid services you have used before to help with your work. I would like the project to be completed i...
I need a professional who can help me with scraping data API from a specific website or platform. I'm looking to extract specific data points or information and potentially set up a regular scraping process. Key Requirements: - Proficiency in Web Scraping: I need someone who has experience with web scraping tools and techniques. - Data Mining Skills: The ability to identify and extract the specific data points I require is crucial. - Automation Expertise: If you have experience setting up automated scraping processes, that would be a huge advantage.
