Vb.net send sms via internet punët
Ne jemi sa me prane konsumatoreve shitjet tona online ne internet
I need someone in Tirana to visit several shopping malls and send me some pictures and information. More info after I award the project. It will be one off visit, and not more than 10 pictures. Kam nevojë për dikë në Tiranë për të vizituar disa qendra tregtare dhe për të më dërguar disa fotografi dhe informata. Më shumë informacion pasi të jap çmimin e projektit. Do të jetë një vizitë dhe jo më shumë se 10 fotografi.
Cena i period rada su indikativni i fleksibilni. Moguce je da bi mi trebalo i manje. Sto se terminologije tice, nije problem, konsultovao sam se sa prijateljem koji radi kao stomatolog ovde u Italiji i zeljan je da mi pomogne.
Cena i period rada su indikativni i fleksibilni. Moguce je da bi mi trebalo i manje. Sto se terminologije tice, nije problem, konsultovao sam se sa prijateljem koji radi kao stomatolog ovde u Italiji i zeljan je da mi pomogne.
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
miredita shqipe pom duhet me qu shum emaila ndoshta munt te mundesh mem ndimuu te pershendes me tmira
I'm in need of high quality 360° video shooting and editing service for a tourism and events project in Orlando, Florida. This footage is meant to be seen via Oculus VR Glasses. Key Details: - The final video duration should be around 2 minutes. - The video will serve tourism and event promotion purposes. Ideal candidates should have: - Proficiency in 360° video shooting and post-production editing. - Demonstrated experience in creating engaging tourism and event videos. - Familiarity with local Orlando scene would be a bonus. Please provide examples of past 360° video projects when bidding. Looking forward to your creative proposals!
I'm in need of a .NET Core developer to create an appraisal system. This system is designed to implement multi-page functionality. The system should be robust and user-friendly, ensuring a seamless user experience. Your primary task will be to build the system according to the provided guidelines. The appraisals can be conducted by the user without the need of connecting to any existing software or databases. Ideal Skills and Experience: - Proficiency in .NET Core - Experience in developing multi-page systems - Strong understanding of user authentication - Familiarity with document uploading - Competency in creating rating and feedback systems The project does not involve any integration with existing software or databases. You will be working on building the appraisal...
...angles, close-ups, lifestyle shots). ###Copyright issue: Ensure that you are not violating any copyright laws when downloading images. Only download images that are publicly available and meant for public use. ###Steps to Collect Images: 1. Preparation: Create a folder structure on your computer to organize the images by product category (e.g., Shoes, T-Shirts, Sofas). Ensure you have a stable internet connection for browsing and downloading images. 2. Finding Images on Amazon: Go to Amazon. Search for a product category (e.g., "Men's Shoes"). Click on individual products to view their detailed pages. Select images that meet the quality and content requirements. Right-click on the image and select “Save Image As…” to download. Name the fi...
We are using the VROOM Project front end for a route optimization tool. The code is open source You can demo it here - We have modified the front end to support uploading data in and XLS format instead of JSON. The data parsing is working but we are looking to improve the data validation to alert the user o...Technician name listed on the WO not found in the technician list (return "[technician name] is missing from the technician sheet") If validation errors occur, add a popup showing the specific errors that a user needs to correct. Depending on the volume of errors, this may need to be scrollable. Start your proposal with your favorite fruit to show you've read this. Changes will have to be submitted via git.
... The models are: (i) Fulfillment by a Seller (FBS) and (ii) Fulfillment by AliExpress (FBA). FBA is when an AliExpress Seller sends products from its factory/warehouse to an AliExpress warehouse, where AliExpress then handles the Order Fulfillment and Shipping. Shipping is done via Cainiao. Source: We want to make use of FBA. This may mean that we need to start a shop on AliExpress which we will link with our Shopify store-front. We will send our products from the factory (Guangdong Province) directly to an AliExpress Warehouse in Guangdong. When we get an order directly from the end-consumer, we want AliExpress to take care of our Order Fulfillment and Shipping, as we want to make use of the low international shipping
I'm looking for an expert in .Net 8 Blazor to enhance our RIS (Radiology Information System) application with several new features, specifically focusing on workflow automation. Key Features to Add: - Workflow Automation: This includes automating the patient registration and check-in process, radiology order entry and tracking, as well as results distribution and notification. Ideal Candidate: - Proficient with .Net 8 Blazor framework - Experienced with Radiology Information Systems - Skilled in workflow automation - Capable of building secure and scalable systems - Understanding of healthcare industry regulations and standards If you have the expertise and experience in these areas, please reach out to discuss this exciting project!
I'm looking for a professional who can assist me in reaching out to my vast old email subscriber list. The job involves sending out messages in a non-spammy, engaging manner. Key Responsibilities: - Send out emails and SMS to a list of over 20,000 users. - Ensure the content is engaging and non-spammy. Ideal Candidate: - Proficient in email marketing tools and strategies. - Skilled in SMS marketing. - Familiarity with managing large subscriber lists. - Excellent written communication skills. If you have experience with successful email and SMS marketing campaigns, and you're confident in maintaining a high level of engagement without spamming, I'd love to discuss working together.
Responsibilities: • Elicit and distill goals, requirements and priorities from customers and other stakeholders • Design and develop software systems, applications, and components for a variety of customers and domains. Requirements: • Must know Android development OR Windows Presentation Foundation (a minimum of 5 years) • C# .NET OR Java (a minimum of 5 years) • SQL • Self-motivated and willing to work in many areas of development • Proven experience in designing and developing quality software • Excellent communications skills • Bachelor's Degree in Computer Science, a related field, or equivalent training or professional experience Pluses: • knowledge of MVC, or MVVM Applicants must email (i) a cover letter, (ii) and a r...
JUST ONE PAGE I need an Android application PAGE that can calculate house bill payments, including electricity, water, and internet bills. The application must be developed in Android Studio. BUDGET IS $30-$50 (Should be ready in 2 days max) Essential Features: - The app should have sections for entering current and previous meter readings for electricity. - A section for entering the tariff rate for electricity. - Similar sections for water - current and previous water usage, along with the water tariff rate. Design: - The design should be user-friendly and intuitive. - The UI/UX should be clear, neat, and easily navigable. Skills and Experience: - Proficiency in Android Studio is a must. - Experience in designing and developing user-friendly applications. - Knowledge of finan...
JUST ONE PAGE I need an Android application PAGE that can calculate house bill payments, including electricity, water, and internet bills. The application must be developed in Android Studio. BUDGET IS $30-$50 (Should be ready in 2 days max) Essential Features: - The app should have sections for entering current and previous meter readings for electricity. - A section for entering the tariff rate for electricity. - Similar sections for water - current and previous water usage, along with the water tariff rate. Design: - The design should be user-friendly and intuitive. - The UI/UX should be clear, neat, and easily navigable. Skills and Experience: - Proficiency in Android Studio is a must. - Experience in designing and developing user-friendly applications. - Knowledge of finan...
Having problems with Docker and need configurations 1 - 3 current running containers need proper ports assigned to them. The containers connect be lost as they are for production. 2 - set up and configure three additional separate Docker groups, each fo... load balancing, and security although specific requirements for each are not yet defined Ideal Freelancer: - Proven experience in Docker containerization - Familiarity with setting up and managing production environments - Strong understanding of port assignment and management - Capability for creating isolated environments for different entities - Paying $10 for the project. - All work done via AnyDesk, no SSH. Please feel free to reach out to clarify any requirements or suggest any additional best practices for our Doc...
THE PROJECT MUST BE DONE ON MS VISUAL STUDIO - MY BUDGET IS $30-50 , ANYTHING MORE THAN THAT DON'T APPLY. ALSO TIMEFRAME IS 4 DAYS I'm seeking a skilled .NET developer to design an efficient, user-friendly inventory management system for a luxury shoe shop. 1. The Project should have/do the following: a. Product screen • Add product • Edit product • Delete product b. Category Screen • Add Category • Edit Category • Delete Category c. Subcategory Screen • Add Subcategory • Edit Subcategory • Delete Subcategory d. User Screen • Add User • Edit User • Delete User e. Edit Stock Screen • Add Stock Amount of Each product • Edit Stock Amount of Each Product 2. There should be a database for each screen 3. I...
We have an existing platform that fetches top news headlines based on interest and uses GPT in order to compile them into a headline and send via SMS. The current bot is a selenium and existing panel is a basic Django admin. These are the new revamps that I'm looking for Scraper Fix: Need scraper fixed so it utilizes a blend of IP address locational data to find content that interests, and is more centered on things United States people would enjoy reading about. The current texts sometimes show Indian news that is out of context. So need a revamp of the news finding system in order to actually find meaningful arcticles and headlines. Right now it shows nothing that would be at the top of google news with a quick glance. Also would be nice to integrate twitter n...
I am looking for an experienced freelancer who can support my B2B business in crafting and managing LinkedIn posts and MailChimp email marketing (E-Shots). Key Tasks: - Creation and management of engaging LinkedIn posts. - Creation and dissemination of custom offers via MailChimp E-Shots. - Providing graphic design for both LinkedIn posts and E-Shots. Ideal Skills and Experience: - Proficiency in LinkedIn and MailChimp platforms. - Experience in B2B Social Media Marketing. - Knowledge in creating custom offers suitable for B2B businesses. - Expertise in graphic design. - Proven ability to manage and optimize LinkedIn posts and MailChimp E-Shots. I'm ideally searching for a freelancer who appreciates the importance of custom offers and can manifest this in both LinkedIn ...
Hi, I have built a SCARA robot-arm, but need someone to help me to arrange electronics (RPI. ESP32, OPI) and software for it. 3 if its axes are driven by closed-loop stepper motors, each with its own internal driver and encoder and CANBUS connection. Another axis for vertical movement is a regular industrial servo motor that comes with an externa servo driver that is also connected via CANBUS. So all 4 motors need a controller able to control the arms all motors so the arm moves fast and with fluid and organically movements without any jerkiness. The arm will have 34 fixed points in space where is will pickup or deliver a small plastic containers. Pickup will have its own standard travel path and deliver will have it own as well. The differences is how it hooks into the container...
I'm in need of an experienced illustrator to help with my project. I have 10 modules of Yoga Teacher Training Powerpoints which have used available images from internet searches. I would like these to be standardised and drawn to be copyrighted. Existing illustrations may be copied and amended. At a high level, you'll need to: - Design and create illustrations for 10 sets of PowerPoint slides - Ensure the illustrations are minimalistic, yet specific to the theme of yoga. The illustrations should include: - A variety of yoga postures and techniques. Ideal candidates will have: - Strong illustration skills, especially in creating specific themed content. - Experience with PowerPoint formatting. - A portfolio that demonstrates their abilities in creating minimalistic art...
...corporate logos and branding materials. The designed logo and branding materials should communicate professionalism and be instantly recognizable. The message thematically tied to the logo should embody clean energy, environmental preservation, and prosperity while highlighting the concept of a new era of re-industrialization in responsible stages of readiness and gradual decarbonization, aiming for Net Zero between 2030-2050, but also centred around freedom to choose, reliability and self sufficiency. Also, the design should symbolize Energy Transition, Innovation, and Best Practice while promoting Responsible Citizenship, Stewardship, and Affordability. Ideally the logo communicates the best value for both industrial and commercial customers, emphasizing an optimal cost-quali...
...corporate logos and branding materials. The designed logo and branding materials should communicate professionalism and be instantly recognizable. The message thematically tied to the logo should embody clean energy, environmental preservation, and prosperity while highlighting the concept of a new era of re-industrialization in responsible stages of readiness and gradual decarbonization, aiming for Net Zero between 2030-2050, but also centred around freedom to choose, reliability and self sufficiency. Also, the design should symbolize Energy Transition, Innovation, and Best Practice while promoting Responsible Citizenship, Stewardship, and Affordability. Ideally the logo communicates the best value for both industrial and commercial customers, emphasizing an optimal cost-quali...
I need help with a data entry task that involves extracting data from various websites and inputting it into an Excel spreadsheet. Th...Ongoing work (Not full time) but will transition to full time About Us: We are a recruitment agency looking for a reliable Virtual Assistant to help with administrative tasks. Responsibilities: Manage Google Workspace (Gmail, Calendar, Drive, Docs) Handle domain management via GoDaddy Assist with email communications Update records and databases Requirements: Experience as a Virtual Assistant or in a similar role Proficient in Google Workspace Familiar with GoDaddy Strong communication and organizational skills Reliable internet connection To Apply: DM your resume. Tell me 3 reasons why you would be the right fit. We look forward to ...
I am looking for an experienced API Integration Specialist to help automate the sales of eSIM cards using on the GetYourGuide platform. The integration should be done via (formerly Integromat). **Project Requirements:** 1. **API Integration**: Connect the eSIM API from to GetYourGuide via Make.com. 2. **Automated Workflow**: Set up automated workflows to handle: - Order processing and fulfillment - Customer notifications and delivery of eSIM cards - Payment confirmation and reconciliation 3. **Testing and Validation**: Ensure the integration works seamlessly, handling all edge cases. 4. **Documentation**: Provide detailed documentation of the integration process and workflows for future reference. **Skills Required:** - Experience with
With a core requirement of driving website traffic, I am seeking a social media marketing expert who can strategize and execute a campaign on Facebook, Instagram, and LinkedIn. Key Tasks: - Develop organic and paid campaigns with engaging content to boost website visits - Monitor key metrics, and optimize strategy to improve results - Effectively target and engage with business professionals Ideal Candidate: They should have proven experience in successfully driving website traffic through social media campaigns. A good understanding of various advertising strategies suitable for Facebook, Instagram, and LinkedIn platforms is a must. Furthermore, an ability to identify with and influence business professionals would be a significant advantage.
...SKUs in an Excel sheet that I need corresponding images scraped from Website A. Each image should be saved with the SKU number as the filename (e.g., for SKU 32440). Key Requirements: - Scrape images from Website A for 2060 SKUs - Save each image as a high-resolution jpg with the SKU number as the filename Delivery: - I will provide you with the Excel sheet containing the list of SKUs via email. - You should deliver the images in a compressed file with 2060 images, each named according to the corresponding SKU. Ideal Skills and Experience: - Experience in web scraping, particularly image scraping - Proficient in Excel for managing SKU lists - Ability to deliver high-resolution images - Attention to detail to ensure correct matching of SKUs and images Please, let me know if ...
Hi, We need a creative scriptwriter with a great sense of humor and knowledge of jokes and meme trends. I need many scripts related to the animal niche. I will ask for a 100 -150 word sample on the topic given by me. It's a long term task we need 8 scripts of 2000 words per week. We will hire multiple writers for this task. Have you had e...to the animal niche. I will ask for a 100 -150 word sample on the topic given by me. It's a long term task we need 8 scripts of 2000 words per week. We will hire multiple writers for this task. Have you had experience writing for a YouTube channel before? If so, we would love to see the links to your work. Additionally, please share some sample scripts that you have written. Payment will be via escrow. Interested candidate pleas...
I am looking to develop a Variable Message Sign (VMS) software. The software should be: - Compatible with Windows - Able to facilitate message scheduling and display - Support remot...the clients added. The user Manual for the software is attached, Please Go through the manual and get Details. For the software demo, please access: ViPlex 64 bit: (X64).zip 32bit: This project requires a skilled .NET developer with experience in developing software for the Windows platform. Previous experience with traffic management software or VMS systems would be a great advantage. Please provide a relevant project portfolio.
Responsibilities Own projects cross functionally/across teams Takes on the most challenging development projects. Identifies and proactively tackles these major challenges. Leads adoption of new tools, methodologies, and systems. Gives guidance, unblocks others, and may function as team lead May function as a team or segment lead Mentors more junior developers Follow standard software development life cycle processes Develop, test and maintain enterprise applications Design and implement complex enterprise applications Continuously innovate and modernize applicable software development technologies and trends Perform code reviews Create and maintain appropriate documentation Communicate effectively with operational teams with complex software concepts Translate technical requirements, dev...
...frontend will be built using React.js and Material-UI to ensure a modern, responsive, and fast-loading user interface. Hosting and CDN: DigitalOcean will be our hosting provider, while Cloudflare will be used as the CDN to improve the speed and security of the website. Speed Considerations: It is important to note that the technological infrastructure must be optimized to load quickly, even on slow Internet connections, which are common in Cuba. Therefore, we need the development team to have experience in developing websites with these considerations in mind. Request for Quote: Please provide us with a detailed quote that includes the costs associated with backend development and frontend developmen. We would appreciate any additional information about your approach to ensuring...
I am currently seeking a skilled and experienced C# developer with expertise in the .NET framework. The primary task at hand is to implement advanced background job features within the project, with a specific focus on Asynchronous Processing and Queue Management. Key Deliverables: - Implement Asynchronous Processing: The developer should be able to design and implement a system where tasks can be processed concurrently, allowing for better performance and resource utilization. - Implement Queue Management: The project requires a developer who can set up a robust queue management system, ensuring tasks are executed in the correct order and at the right time. Specific Requirements: - Maximum Queue Size: The system needs to be designed with scalability in mind. You should be able ...
I'm in need of a skilled developer who can build a .NET middle layer for me. This layer will be responsible for calling an external API and handling the responses in a JSON format. The requirement is to design the system in a way that the output is stored in a JSON file. Key Requirements: - Build a .NET middle layer for API calls - Handle API responses in JSON format - Save the output in a JSON file I need this layer to be manually triggered on-demand. This is a crucial aspect of the project, so reliability is key. Ideal Skills: - Proficiency in .NET development - Experience with APIs, especially handling JSON data - Ability to design systems for manual triggers Experience in similar projects is a big plus, so please provide relevant examples in your proposa...
I am looking for ready made chat application built in .net core. Only looking for ready made projects. Features- Edit message, Delete message, Create Group, Status... I need features which is available in google chat.
...front-end frameworks and libraries. Knowledge of modern UI/UX design principles. Spanish language skills are a plus but not mandatory. What We Offer: Flexible working hours. The opportunity to work on cutting-edge projects. Competitive compensation based on experience and project scope. How to Apply: If you are interested in this opportunity and meet the requirements, please submit your proposal via Upwork. Include your resume, a portfolio of relevant work, and a brief description of your experience with and Stable Diffusion. We look forward to seeing your application!...
The Role: We are seeking an Application Developer to join our strong and growing Information Technology group at the California Association of REALTORS® (C.A.R.). This person will work in a team to design, develop, and support mission critical applications. The ideal candidate would be an expert in .NET MVC development using C#, and have experience developing and interfacing with SQL Server databases. The Application Developer creates, maintains, supports, extends and operates computer applications that serve the C.A.R. membership, the general public, and C.A.R. internal staff. The application portfolio is very broad ranging from communication tools to mobile applications, internal data processing applications, database applications, and applications that support our members&r...
I did convert my existing old website (built 2004) to a responsive html5 website. As a first step I did convert the Homepage () and the into a responsive page without changing the design (look and feel). But the Homepage had only two (horizontal) Navigations. Other pages have an additional vertical navigation on the left side of...integrated into the responsive navigation. Additional Notes: * Please don´t bid if you don´t have (and can show me) experience with this kind of work; I would like to see working examples beforeward; * To show that you've read and understand the project requirements, please include the phrase "hello pk" in your bid. Failure to include this will eliminate you from consideration. * Payment via escrow account only ...
...affecting usability and reducing customer engagement. Key Project Deliverables: • Redesign with a Minimalistic and Sleek Aesthetic: The new design should be clean and modern to reflect our brand's personality. • Improved Navigation: It's crucial that users can find what they’re looking for without a struggle. • Fast Website Loading Speed: The website must load quickly to keep up with today's internet users who have little patience for slow loading sites. Ideal skills and experience for the task include: • Proven experience in website design and conversion optimization. • An understanding of modern design principles, with a flair for creating sleek and minimalistic visuals. • A solid track record in improving website sp...
Need an android app to generate a pdf document. We have following fields to fill up and also et the end we need to be able to add a signature. - number - date - name - id series -id number - personal identification number - city - address - county - starting date - net income - gross income need to be able to generate pdf and also email option to send directly to email and print option
As a .NET developer with expertise in multi-tenant functionality, I am in need of a professional who can help me implement and refine this feature within my web application. It involves user authentication, tenant administration, and data isolation. Key Requirements: - Implement a robust user authentication system, ensuring that only authorized users have access to the system. - Develop a seamless tenant administration system, allowing me to manage different tenants within the application. - Ensure data isolation is maintained between tenants, guaranteeing that each tenant's data is secure and isolated from others. - Integrate DNS functionality within the application, allowing me to manage DNS, configure DNS records and resolve DNS queries. Ideal Skills: - Proven experience...
(ALL INFO IN DESCRIPTION-SEND ACCURATE BID ELSE YOU WILL BE REPORTED)****** I'm looking for an experienced developer who can create a web-based calendar with a unique feature to allow my users admin to book dates. If a date is unavailable, the application should clearly indicate it. Calendar app **1. User Registration:** - Admin creates a new user by providing a username and password. - Store the user's credentials securely in a database, with password hashing and salting for security. -Allow user to make remember me so they don’t have to login each time. **2. User Login:** - User enters their username and password on the login page. - The system checks the provided credentials against the database records. - If the credentials are valid, the user is granted a...
We have different Brochures, but now search a new Layout in A4 Page and A5 Page. How can you help us, can you design our layout from now a little more professional and update the brochure. For future, we would like give self products in the pages - always more and bigger and need than every month a feedback and update ...search a new Layout in A4 Page and A5 Page. How can you help us, can you design our layout from now a little more professional and update the brochure. For future, we would like give self products in the pages - always more and bigger and need than every month a feedback and update from you. What is possible ? Language German References for Vehicle (Car/Truck) Brochures ? Send us layout samples from your works via message, after this we check and yo...
Create an auto process that will run every minute do the below:...below: 1) Will open Google Chrome. 2) Pull from external endpoint JSON (I will provide) a list of urls and enter each one of them in a new window. 3) In case one of the websites is showing "Dangerous Alert" (or doesnt load from any reason) , an email alert + SMS alert should be sent to multiple contacts that I will provide. Some points and clarifications: A) It can be done with extention, desktop software or any other auto script B) It will run every 60 seconds C) It will be installed on 3 RDPs D) I will need help to find and connect to SMS service and RDP service as I dont know reliable services that can be registered and approved fast. Please provide me a detailed solution how you will plan to do...
...workbook that manages electronic components, their stock levels, and inventory updates post-sales efficiently. - BOM creation from inventory items with an ability to incorporate "other costs" into each assembly. - Stock purchase entries should automatically update inventory quantities and costs. - Detailed sales tracking with automatic inventory quantity adjustments. - Low stock level notifications via highlighted rows in the spreadsheet. - The system should allow easy expansion for adding new sales data, inventory items, saved BOMs, assemblies, types or categories. **Skills Required:** - Demonstrated experience in BOM and Inventory system development. - Advanced Excel Macros and VBA skills. - An analytical approach with a focus on delivering simple and functional ...
