Writting sql xml file vb net punët
Pershendetje Glen. Jam e interesuar per ndihmen tuaj ne SQL. Do te me duhet ndihma jote ne nje provim neser. A mundeni te me ndihmoni me nje shume prej 10 euro per 1 or e gjysem?
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
I need a Python developer to create a tool for me that can convert different file formats. Although I did not specify the particular formats, I am looking to convert at least two different formats. The tool should have a user-friendly interface and be able to handle these conversions seamlessly. Ideal skills and experience for this job include: - Proficiency in Python - Experience in creating file conversion tools - Knowledge of different file formats - Strong problem-solving skills - Ability to create a user-friendly interface - Understanding of data handling and manipulation Complete details will be provided to shortlisted candidates.
Hello, We are F12Design, a platform where customers and designers come together and collaborate on graphic design projects. We would like to build an interactive dashboard to make the workflow simple and effective. Here are a few things on our mind: Languages - (Please free to suggest your own) Backend - PHP, jQuery, and SQL Frontend - HTML, CSS, and JavaScript For Real-time Demo/Example - Please sign up for and check their dashboard ########################################################## Social Login/Create account (Separate customer and Designer Login) ########################################################### Customer Dashboard Order Handling -------------- Past Orders Order Requirements (Quiz* and additional comments) Order Updates Order Delivery Date Order Tracking
Se requiere un profesional que pueda diseñar un reporte en "SQL Server Report Builder". Este reporte, será modelo factura o pedido. Ya se cuenta con la consulta, y los parámetros de consulta (Fecha, desde - hasta), y también por número de documento (Desde - hasta).
Necesito generar deshboard y gráficos en Power bi desde 4 bases de datos • 1 base de dato en postgresql corporativa en aws • 1 base de datos en sqlserver en un servidor local • Google Analytics • Zendesk Son aproximadamente 50 gráficos personalizados con los que necesitamos hacer algunos dashboard de gestión. Es importante dejar documentado el trabajo y respaldadas las consultas en sql. Indispensable: • Dominio de Power BI • Experiencia previa en la creación de paneles para ejecutivos • Capacidad para integrar datos de bases de datos Indicar los accesos requeridos y los requerimientos tecnológicos para desarrollar el proyecto
I'm looking for a skilled freelancer to develop a customized net worth spreadsheet. This spreadsheet should enable me to meticulously track my financial progress across various categories. Key Requirements: - The spreadsheet should allow me to input and monitor: - Investments (especially individual stocks) - Debt - Savings - Income - Expenses - Other category for miscellaneous expenses or income - I require a simple, user-friendly design that makes manual data entry easy and intuitive. Skills and Experience: - Proficiency in spreadsheet software such as Excel or Google Sheets is essential. - Experience in financial tracking and net worth management is highly beneficial. - Understanding of stock market, investment tracking, and basic accounting principle...
PDF File converted to MS WORD File more than 300 pages Need ASAP
I'm searching for a professional who is proficient in SQL coding specifically for MySQL database design. PowerShell scripting or similar would also be beneficial. This is a basic level project taking existing Local government procedures and converting them into SQL based processes. An example of which would be creating a import procedure for traffic count data that is presented in a text format (example attached) Ideal Skills: - Experienced with MySQL Database Design - Well-versed in SQL coding - Ability to simplify complex instructions - PowerShell for anything not possible in SQL This project will demand creativity and intelligence to design procedures that simplify data entry processes. Please only bid if you can offer solutions according to the...
I'm looking for someone experienced in running projects from GitHub repositories "" to assist me in setting up and running the demo-k6-operator project on my Mac machine. Your guidance should help me to understand how this project works, which is my primary goal. Key requirements: - Expertise in running and configuring projects from GitHub repositories on Mac machines - Solid understanding of the demo-k6-operator project - Ability to provide clear, detailed instructions and guidance for running the project on my machine - Patience and willingness to explain concepts to help me understand the project better The specific challenge we may face is that I'm using a Mac CPU that is NOT Intel, so experience with this kind
...aim of the project is to create a nodeJS program that will retrieve an xls file from an email inbox in order to geocode the addresses present in the file via the Google Maps API and insert the geographic coordinates into an SQL table. You can follow these steps: 1. Retrieve the xls file from the mailbox - cron every hour 2. Normalize the xls file for integration into a MySQL table 3. Configure access to SQL database from JavaScript. 4. Insert data into table via SQL query 5. Retrieve addresses to be geocoded from the SQL table. 6. Use Google Maps API to geocode each address. 7. Insert the geographical coordinates (latitude and longitude) in the SQL table. Each line in the xls file corresponds to a delivery. The ...
...need assistance with scraping data from a website and delivering it in an Excel file. The specifics of the project are as follows: I am looking for a person who will conduct scraping sessions for our business on a regular basis. Desired skills are knowledge of screen-scraper software, sql, Someone with Python knowledge will be better. Willing to follow instructions. Not cramped up with other jobs or other side hustles. Need to have solid internet connection. Expected work takes 5-10 hours per week, once fully trained. Must be responsible. Able to accept PayPal. - The source of the data is a website. This means the freelancer needs to have experience in web scraping. - The data should be delivered in an Excel file. Proficiency in handling and formatting data int...
Data Specialist: The Data Specialist is responsible for pr...information that is in databases, organizing and assembling the information so that teams can make decisions using data. Responsabilities: > Access database. > Create dashboards and analysis according to the demand of the business areas. > Update and automate dashboards that need frequent updating. > Provide suggestions of improvements in business areas. Requirements: > Mandarim is a must > SQL > Office Package > Database usage At Shein, we believe that diversity is the force that drives innovation. We are committed to creating an environment where all voices are heard, valued and respected. All our vacancies are inclusive for people with disabilities, women, black people, LGBTQIAPN+ com...
...facilitating easy file sharing among a small number of devices, specifically less than 10. Key requirements: - Establish a Local Area Network: The main goal of the project is to set up a local network that ensures a seamless connection among the devices for file sharing purpose. - Secure File Sharing: The network should be configured in a way that file sharing is secure and only accessible to the authorized devices. - Minimal Device Connectivity: As the network is intended for a small group of less than 10 devices, the setup should be simple and efficient without compromising security. Ideal Skills: - Networking Expertise: A deep understanding of LAN setups and configurations is crucial. - File Sharing Knowledge: Experience in setting up networks for...
I need a skilled professional who's an expert in Azure Data Factory (ADF) development, SQL, Power BI, and ADF monitoring. Key Tasks: - Creating data pipelines - Building data transformation workflows - Integrating with SQL databases Power BI Usage: - Visualizing data through interactive dashboards - Creating data reports and analytics - Real-time monitoring and alerts ADF Monitoring: - Tracking data pipeline performance - Monitoring data integration processes - Setting up alerts and notifications for job failures. Ideal Skills and Experience: - Expertise in Azure Data Factory (ADF) development - Proficiency in SQL, Power BI, and data visualization - Strong background in monitoring ADF performance - Experience setting up real-time alerts and notifications - Pr...
Hello, I have my Python/Django site hosted on PythonAnywhere and it's facing a NET::ERR_CERT_DATE_INVALID issue. Website : I would appreciate someone help to troubleshoot this issue and fix the NET::ERR_CERT_DATE_INVALID error, ensuring that the SSL/TLS certificate is correctly set up. - Website troubleshooting and error resolution - SSL/TLS certificate configuration. Thanks in advance !
I'm seeking an experienced DevOps engineer who is proficient in deploying React Frontend and .NET Core 8 applications to Alma Linux with NGinx server. The candidate should have solid experience with: - Deploying React FrontEnd and .NET Core 8 Web API applications on Alma Linux in GoDaddy VPS. - Knowledge of routing of both applications with one domain and one SSL. - Knowledge of handling SubDomain. - Knowledge of Alma Linux Nginx deployment. - Understanding of .NET Core Application Settings and React.JS application settings - Understanding of Node.JS
I'm seeking an independent ASP.NET developer based in India with at least 5 years of experience, strong C# programming skills, and familiarity with SQL Server and Asp.net core. Your English skills will be crucial as direct communication with me is required. Key Responsibilities: - Develop a robust business management system leveraging ASP.NET - Implement user authentication and authorization features - Integrate appropriate APIs to enhance system functionality Ideal Candidate: - Minimum 5 years experience in ASP.NET development - Proficient in C# programming and SQL Server - Familiarity with Asp.net core - Experience in developing business management systems preferred - Strong communication skills for client call Please note that this project is only open to Indian-ba...
I'm seeking a data operator skilled in the analysis and visualization of numerical data. The primary task is to handle the numerical data in my CSV file. Key responsibilities include: - Data Analysis: You'll be responsible for performing thorough data analysis on the numerical figures in the file. - Data Visualization: In addition to the analysis, I need engaging visualizations of the data to be created. This will help to communicate the insights effectively. Specific tasks I need help with include: - Descriptive Statistics: You should be able to calculate and present descriptive statistics for the data. - Trend Analysis: You'll also need to identify and represent any trends present in the numerical values. Ideal candidates for this project should: - Have...
... The role may also involve programming. Key points: - Coaching: I need 1/1 coaching via Teams on Data Analysis & Data Visualization within Azure Analytics - Programming: If the opportunity arises, the candidate could get involved in programming using SQL - Proficiency: I consider myself at an Intermediate level with Azure Analytics Ideal Skills and Experience: - Proficient in Azure Analytics: You should have a strong understanding of Azure Analytics, specifically in Data Analysis and Data Visualization - SQL Programming: Experience with SQL is a must as you may be involved in programming for this project - Teaching or Coaching Experience: Prior experience in teaching or coaching Azure Analytics would be advantageous - Strong Communication: The ability to clear...
A business-centric, data-oriented, and analytical mindset. Comprehensive knowledge of data science concepts and disciplines. Knowledge of enterprise information management processes and methodologies. Skills in database design, data security, and data lifecycle ...considerations. . Combinations of experience and education will be considered on a case-by-case basis. Experience in data warehousing and governance. Practical experience in enabling data usability, availability, and efficiency. Experience in data management, quality, metadata management, and modeling. Knowledge of database systems: MS SQL Server, Oracle, or another commercial RDBMS required, Snowflake, or other non-relational database desired. Knowledge of SQL. Experience with scripting languages, especially Python...
I need a skilled .Net MAUI developer to assist me with my existing project. The main tasks for this project include: - Fixing bugs: The project is currently experiencing some issues which are negatively affecting the user experience. The specific bugs are not provided in this brief, but I can share details during our discussion. - App Publishing: Once the bugs are resolved, you will be responsible for publishing the updated version of the app to both Android and iOS stores. - Delivery of the final source code and making sure it is running on our machine. The ideal freelancer for this project should: - Have a proven track record in debugging and resolving issues in .Net MAUI projects. - Be proficient in the publishing process for both Android and iOS stores and should b...
I'm in need of a skilled developer who is experienced with inventory management systems, report production, analytics, user access control, and Windows-based applications. This job involves maintenance of a warranty return tracking software, with specific attention to: -...considered a plus. The overriding purpose of this software is to track and manage warranty returns effectively. Ideally, you should have previous experience in software creation and maintenance for tracking and managing products. The purpose of this project would be Bug fixing and improvement of the software tool already existing. Required: Experience with ER Models architecture Experience with MS SQL server 2017 express as DBMS Experience with Python 3.8.3 and Tkinter GUI toolkit Experience with Powe...
Need to convert text file to a clean page and remove the colums showing passwords.
I have a STEP file of a PCB that includes submodels of various components. Each submodel is named by the component, e.g., resistor 0402. I need someone experienced to identify and accurately place components (e.g., resistors) in the STEP file. Attention to detail and precision are crucial for this job. Start comment with fustion3
I need an adept SQL developer proficient in crafting SQL queries for various tables within our database. The task entails generating four queries, each encompassing approximately 20 conditions that must be met. Utilizing ChatGPT, could you assist in devising these queries?
I'm in need of an experienced SQL Server data warehouse designer to help with a project of integrating and consolidating data from different sources. Key requirements: - Expertise in SQL Server: You should be able to design, implement and optimize data warehouse solutions on SQL Server. Understanding data warehouse design principles is essential. - Data Integration: You'll need to work with some of our developers / power users to source data and establish automated integration; experience with integrating relational databases and APIs from web services is crucial. - Data Consolidation: You should be able to create a cohesive, consolidated dataset from these different sources applying appropriate design principles. - Medium-sized project: The data needing in...
Ideal Skills and Experience: - Proficient in C# programming language and .NET framework - Experience in developing desktop applications - Familiarity with Visual Studio - Ability to implement data encryption and database integration - Expertise in developing secure user authentication mechanisms Please provide relevant examples of your previous work in C# desktop application development.
I need a professional website that aptly portrays my investment advisory services and showcases my portfolio. The website should cater to individual investors, small business owners, and high-net-worth individuals. Key Features: - Detailed and clear information about my advisory services: Candidates with experience in creating informative and engaging content relating to finance or investments will have an advantage. - An investment portfolio section: The ideal freelancer should demonstrate an ability to elegantly display financial data in an accessible manner. - A contact form: Allow visitors to submit inquiries directly through the site. - An investment calculator: This needs to be user-friendly and visually appealing, requiring both frontend and backend capabilities. Ideal...
...accessories field. If you have the creativity and skills to bring fresh ideas and elegant solutions, please send us your portfolio. Let’s create something amazing together! This project involves Arabic-inspired products. Based in Kuwait ?? Thanks Plz read carefully before replying , your 1st understanding of the project will effect my decision..! Attached suggested logo and some references from the net .. regards...
Note: Budget Fix 2000INR and time line 5 Day's I have a project currently in Codeigniter 3, and I'd like it converted to Laravel 10. This pro...will require thorough understanding of both frameworks, and it's crucial that all existing features and functionalities are precisely replicated in the new version. While I don't have specific features to prioritize, I will identify specific elements as the project progresses. Skills and experience required: - Profound knowledge in Codeigniter 3 and Laravel 10 - Expertise in PHP development and SQL databases - Proven experience in similar conversion projects Note: The finalized budget for this project is 2000INR. Please only bid if you can work within this budget. The timeline for project completion can be discussed d...
I have a medium-sized data entry project which requires entering between 100 to 1000 entries. The data to be entered is primarily textual in nature. This project involves: - Entering textual data into a specific format Ideal Freelancer: - Attention to detail - Proficiency in data entry - Fast and Reliable - Experience with medium-sized data entry projects
I'm l...outreach, and connections to identify suitable candidates. - Running Portfolios: Coordinate the portfolios of these individuals, tracking their performance and making strategic adjustments as needed. - Generating Portfolios via Events: Plan and execute events that attract potential club presidents and generate new portfolios. The ideal candidate should have: - Proven experience in sourcing high-net-worth individuals - An existing network in the business and finance world - Strong project management skills, especially in portfolio management - Excellent communication and negotiation skills This project will be handled collaboratively, so I'm looking for someone who can bring creativity and strategic vision to the table. Please provide details of your relevant expe...
...high-complexity T-SQL stored procedure used for data analysis that I need translated into PySpark code. The procedure involves advanced SQL operations, temporary tables, and dynamic SQL. It currently handles over 10GB of data. - Skills Required: - Strong understanding and experience in PySpark and T-SQL languages - Proficiency in transforming high complexity SQL scripts to PySpark - Experience with large volume data processing - Job Scope: - Understand the functionality of the existing T-SQL stored procedure - Rewrite the procedure to return the same results using PySpark - Test the new script with the provided data set The successful freelancer will assure that the new PySpark script can handle a large volume of data and maintai...
We are a direct, private money lender, and we need assistance remaking two of our loan program documents. Key Requirements: - Branding: The files should reflect the professionalism of our brand - Design: They ...lender, and we need assistance remaking two of our loan program documents. Key Requirements: - Branding: The files should reflect the professionalism of our brand - Design: They should be visually appealing and engaging, suitable for a professional audience - Informative: The documents should be able to convey all of the information in a digestible manner - File Format: I need the final designs in an Adobe or Figma file format. - Output: we should be given two separate files We have included the two files to be remade + the company colors that we us...
Our existing CGI script is encountering issues when importing the exam's section breakdown from a .dat file. Due to this, we are unable to import the breakdown of results per section of the exam into the SQL database. We are seeking a proficient developer who can: - Analyze our existing CGI script and identify the cause of the breakdown import issue. - Provide actionable advice and steps to troubleshoot and resolve the problem. - Ensure the script effectively imports the section breakdown from the .dat file as intended. The ideal candidate for this project should have: - Extensive experience in CGI scripting and SQL database management. - Proficiency in handling and troubleshooting data import/export issues. - Ability to work quickly and effic...
My project requires an experienced programmer who has the technical abilities to modify an XSL style sheet and adjust its layout. The task will specifically focus on: - Changing the layout of the style sheet and VB code. This modification is needed to appropriately accommodate some new fields that have been added to an import file. - Improving the style sheet so as to automatically map the new fields from the import file. The ideal candidate for this job should have experience with layout adjustments in XSL style sheets, automatic mapping of new fields and VB coding. Your skills and experience in rearranging content layout, updating fonts & colors, and altering data display formats will be highly appreciated. Don't hesitate to place your bid if you...
...Development: Use HTML, CSS, and JavaScript for the frontend, with frameworks like React or Angular to enhance the user interface. Backend Development: Python with Flask or Django for server-side logic, handling API integrations, and user data management. Machine Learning: Use TensorFlow or PyTorch for building the recommendation engine, and NLTK or similar libraries for sentiment analysis. Data Management: SQL or NoSQL database to store user profiles and their preferences. Version Control: Git for source code management and collaboration. Submission Requirements: Code: Source code with comprehensive comments detailing the functionality of each part of the system. Documentation: A detailed documentation covering the system design, implementation details, and instructions for setti...
I'm in need of an experienced web developer with strong shell scripting skills. While the main purpose of the website application is not specified, it's targeted at the general public. Ideal Skills and Experience: - Proven expertise in web application development - Experience in creating websites geared towards the general public - Robust skills in shell scripting - Ability to independently make decisions to enhance website functionalities Note: As the tasks for shell scripting are undefined, a flexible way of working is preferred for meeting emergent needs in the project.
...warehousing, ad hoc reporting, complex SQL formation, and more. The primary purpose of the project is to streamline and enhance our data storage capabilities. By integrating new data into our warehouse on a monthly basis, we aim to improve our decision-making and business performance through enhanced data access and analysis. Key responsibilities include: - Reviewing and providing recommendations on the SOW for data warehousing - Offering expertise on ad hoc reporting and complex SQL formation - Helping to streamline data storage and improve decision-making - Ensuring the architecture can support monthly data integrations Ideal candidates should have: - Proven experience as a data architect - Expertise in data warehousing and ad hoc reporting - Strong SQL skills,...
...up-to-date with the latest trends and technologies in database management and architecture. Skills and Qualifications Bachelor's degree in Computer Science, Information Technology, or a related field. Master's degree preferred. 8+ years of total experience. Minimum of 5 years of experience in database architecture and development, with a focus on Netezza and Oracle. Proficiency in SQL and PL/SQL programming languages. Strong understanding of database design principles and data modeling techniques. Experience with database performance tuning and optimization. Excellent communication and leadership skills. Ability to work effectively in a fast-paced environment and manage multiple priorities. Relevant certifications in Netezza and Oracle te...
I'm looking for a professional to recreate a logo and provide the files in PNG, JPEG, and EPS formats. Key Requirements: - Recreate an existing logo exactly but make shot glasses cheers, not stacked.. - Provide the logo in PNG, JPEG, and EPS formats Timeframe: - I would like this done ASAP. Ideal Skills and Experience: - Proficiency in graphic design - Strong attention to detail...and provide the files in PNG, JPEG, and EPS formats. Key Requirements: - Recreate an existing logo exactly but make shot glasses cheers, not stacked.. - Provide the logo in PNG, JPEG, and EPS formats Timeframe: - I would like this done ASAP. Ideal Skills and Experience: - Proficiency in graphic design - Strong attention to detail - Experience recreating logos - Ability to deliver in multiple f...
I have a frontend project built using React and Mobx. The main focus of this project is to clean up the code structure while enhancing the performance of the app. Understanding of .net would be a great plus. Key requirements: 1. **Code Structure Cleanup:** The existing code structure needs to be reorganized and optimized to ensure it's well-maintained and scalable in the future. 2. **Performance Improvement:** The main goal of this cleanup is to enhance the performance of the app. This might involve identifying and removing any redundant code, refactoring certain functions, or optimizing data flow. 3. **Coding Standards:** While there are no strict coding standards in place currently, I'm open to suggestions on implementing best practices. The chosen freelancer should b...
Looking for a Senior BDA with experience in. AZURE SQL SERVER. English mandatory. 1d per week helping to improve and maintain our main DBs.
I am looking for a proficient C# developer who can build a .Net 8 Console application with in-depth CSV handling capabilities. You will need to be able to: - Import CSV files; - Validate CSV data, specifically focusing on data format and range checks; - Convert validated CSV data to a c# DTO format; - Post the converted data to an API. Responding to errors is a significant part of the project. The application should be able to handle any issues encountered during the import, validation, or conversion processes seamlessly. Proficiency in C# is a core necessity, with previous experience in CSV handling and data validation highly desired.
