Develop core banking software vb punët
eclipse php software update in eclipse IDE
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
WE NEED IPTV APP FOR ANDORID WITH ADMIN PANNEL IN PHP TO MANAGE CUSTOMERS . i MUST BE AS THIS IN LINK LOOK THE VIDEO
Software para embarcar hardware Wireless 5.8 GHz MIMO e SiSO, com chipset AR9344
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
qeq kwoekqwoepqwjeoiqwjeoiqj eqwjejwoi ejwqoieqwj oeqwjoejqwoejqwioej qwioejqw oijeqwioejq wejwqio
I'm seeking a talented 2D animator to create engaging educational materials aimed at children aged 3-12. Responsibilities: - Develop creative and age-appropriate 2D animations - Ensure content is both educational and entertaining Ideal Skills and Experience: - Proven experience with 2D animation, particularly in educational settings - Strong understanding of child psychology and educational needs - Ability to create visually appealing content suitable for young audiences This project requires a creative, patient, and meticulous animator who can cater to a young audience. Experience in creating engaging, educational content for children is a plus.
I'm in need of a skilled web designer to create an E-commerce website tailored for freight forwarding. Key requirements: - Your primary goal will be to design and develop a website that drives sales for a freight forwarding service. This will include aspects like advertising, tracking, and the actual e-commerce transactions. - The site is to be optimized for easy navigation, with a strong call-to-action, and a user-friendly interface. - Should be mobile-friendly. - Potential features: As I'm not yet sure about the need for product inventory management and order tracking, I'd prefer a designer who has experience incorporating these features and can advise me on their necessity for my specific project. - Additionally, expertise in SEO and digital marketing would be ...
I'm looking for a highly experienced WordPress plugin developer to work on enhancing the functionality of my website for a dedicated period of one month. Key Requirements: - The main goal of the project is to enhance the functionality of my WordPress website. - You should have over 5 years of experience in WordPress plugin development. - Proficiency in PHP, Java...plugin development. - Proficiency in PHP, JavaScript, HTML/CSS is essential. Experience and Skills Required: - 5+ years in WordPress plugin development. - A strong background in PHP, JavaScript, and HTML/CSS. - Previous experience in WordPress website enhancement. The project duration will be one month, and I need a dedicated professional who can devote their time and expertise to improving the core functionalities...
...the UI/UX design seamlessly with KV Core, a renowned real estate management platform. Key Points: - Specific Color Scheme: I have a particular color scheme in mind for the design. It's vital that the chosen colors align with the theme and message of our brand. - Focus on User Navigation: The most important aspect of the website for me is ensuring user-friendly navigation and ease of use. The design should be intuitive for our target audience. - Target Audience: Our target demographic consists of real estate investors. The design should appeal to this group and facilitate their ease of use and understanding of the interface. Ideal Skills/Experience: - Proficiency in UI/UX design - Experience with real estate industry interfaces - Familiarity with KV Core or similar p...
Seeking a long-term Python Data Scientist and Generative AI expert Your task is to develop a prototype chatbot that is powered by Generative AI and Large Language Model (LLM) to respond to user queries using domain-specific knowledge and RAG implementation. The project will focus on integrating LLM frameworks, managing data preprocessing, and implementing the chatbot's user interactions. ONLY people who respond to below screening questions will be considered: 1) Did you fine-tune an LLM model using LoRA or QLoRA? If so, which model did you fine-tune, and what was the use case? 2) Do you have a GitHub profile? If so, can you share the link? 3) Are you proficient in English, and what is your hourly rate?
I have a domain that I'm looking to sell. It was originally intended for an e-commerce website. As I'm not planning to develop a website using this domain, I'm interested in finding potential buyers who can make the most of its e-commerce potential. Key Points: - The domain is ideal for e-commerce purposes, which makes it a great opportunity for someone in the online sales space. - I'm particularly interested in connecting with individual entrepreneurs, small to medium businesses, and potentially large corporations who are searching for a domain that fits an e-commerce website. I'm looking for someone who can help me find potential buyers and close the sale. This job will require: - Strong networking skills and an understanding of the e-commerce industr...
I am in need of a designer who can create a flyer and postcard full of color and energy for my rental consulting company. This project demands a good understanding of vibrant and captivating designs that seize the attention of the viewer and don't let go. Key Responsibilities: - Develop a bold and colorful design that incorporates company branding - Convey the concept and purpose of the company effectively in the given design Ideal Skills: - Expert in Graphic Design - Strong understanding of branding and promotional designs - Experience in creating flyer and postcard designs I am seeking a quick learner who can grasp the essence of my company and reflect it creatively and vibrantly in the designs. Past experience in similar jobs will be a plus.
I'm seeking a mobile app developer with experience in developing TV applications. The project involves the creation of a TV app that would support live TV streaming specifically. Here are the project specifics: - **Primary Feature**: The main function of the app is to support live TV streaming. This is the core feature that will require meticulous implementation. - **Content Categories**: The live streaming feature will specifically focus on TV content. This includes channels that cater to TV shows, documentaries, or other related TV broadcasts. - **Device Compatibility**: The app should be compatible with Samsung and LG smart TVs. The ability to ensure the app runs smoothly across different models of these brands is crucial. Ideal candidates should have: - Proven experien...
I'm in need of a professional who can address the issues with my current website, which is about 5 years old and has been experiencing error messages. If it's a quick fix, we can proceed with that, but the main aim is to transition to a new solution. Key Tasks: - Review and fix the current error messages. - Backup the current website to prevent data loss. - Develop a new website from scratch, ensuring a clean installation. - Migrate our existing data to the new platform. The key focus for the new website should be on enhancing security, given our experiences with the current site. Content Transition: We aim to maintain the current content with only minor updates. It's important that the freelancer respects the existing narrative and makes changes only where necess...
...unique tungsten ring designs for our business. The ideal candidate will have expertise in CAD software, a strong understanding of materials and manufacturing processes, and a passion for creating innovative and visually appealing jewelry designs. Responsibilities: * Develop an original design for tungsten rings that align with our brand aesthetic and target market preferences. *Create detailed 3D models and technical drawings using CAD software. *Provide regular updates on the design progress and incorporate feedback to refine and finalize designs. Requirements: *Proven experience as a jewelry designer, with a portfolio showcasing previous work in ring design. * Experience working with CAD software (e.g., Rhino, Matrix, SolidWorks) and other design tools. *...
I am looking for a SEO friendly AI Website Content writer who has strong knowledge over US English and can research and wr...company that does management consultancy this is a technical consultancy Also I want to include Gen Ai services in the same. This is a Gen Ai company example : it should look like a management consultancy as well as technical consultancy website with a flavor of Gen AI incorporated Initially 7 to 10 pages would be descent No blogs as of now. just core pages that show that the website is a company which does what I mentioned above So, How would you help me figuring out my website content? P.S. Without reading my details, you should not Bid in GENERIC, else it will be noticed and blacklisted. Thanks for your time!
I'm in need of a talented freelancer to assist with content creation. This project is focused on boosting brand awareness and making our products and services more visible to potential customers. Key Responsibilities: - Conceptualize and create compelling content that resonates with our target audience. - Develop engaging written content or video content that clearly communicates our brand message and value proposition. - Ensure that all content aligns with our brand guidelines and voice. Ideal skills and experience: - Proven track record in content creation, preferably with a focus on brand awareness. - Strong writing and/or video production skills. - Ability to understand and effectively communicate brand values. - Experience in a similar project or industry will be a plus....
...promotional video for my business. The video will be 1-3 minutes long, and should be engaging and captivating. Key Responsibilities: - Develop a storyboard based on the information I provide and your own creative ideas. - Animate the video in a high-quality, professional manner. - Add suitable sound effects and background music. The primary purpose of this video is to market and advertise my business, so it should be visually compelling and easy to understand, even for a general audience. Ideal Skills and Experience: - Proven experience in creating 2D animations, particularly for marketing purposes. - Strong storyboarding skills. - Proficiency in animation software and tools. - Excellent communication skills to ensure a smooth collaboration. I'm looking to ha...
We want to delelop a cibersecurity software/app to Sell to other companies that can check each computer and device, as also as detect treaths to the company network/devices like e-mails, apps, and suspicious content that puts the company security in Treath.
I'm in need of a professional and well-rounded computer programmer to build and manage various software applications. Key Tasks: - Develop innovative web and mobile applications - Manage and maintain the software database Ideal Experience and Skills: - Strong familiarity and skill in programming languages (Java, Python or C++) preferred - Previous experience in database management - Proven track record in developing web and mobile applications While skills in Java, Python, and C++ are a bonus, I'm primarily interested in your ability to perform the tasks specified above. Show me what you've got!
We are seeking a highly skilled and experienced WordPress developer to handle the migration of an existing website to a new hosting provider. This role also involves updating the WordPress core software and all plugins, ensuring the security and integrity of the site, and providing ongoing maintenance. Responsibilities: 1. Migrate the existing WordPress website to a new hosting provider. 2. Update the WordPress core and all installed plugins to their latest versions. 3. Verify the security of all plugins and scripts. 4. Identify and remove malware to clean up the website, which is currently flagged on up to 8 malware sites. 5. Address and resolve any 3rd party malware reports. 6. Provide ongoing WordPress maintenance and security support post-migration. Qualificatio...
...sites efficiently. Blog Management: Editing, publishing, and maintaining high-quality blog posts. Team Collaboration: Working closely with other team members to achieve project goals. Technical Support: Troubleshooting and resolving technical issues on WordPress sites to ensure optimal performance. Qualifications: Proficient in WordPress development and design, with a solid understanding of its core functionalities. Strong skills in Elementor are a significant advantage. Experience in publishing and updating content on WordPress sites. Proficiency in HTML and CSS to customize and enhance WordPress sites. Excellent command of English for effective communication Strong problem-solving skills to troubleshoot and resolve technical issues. Minimum of 2 years experience in Wo...
I need you to develop a DMX link board with NRF24L01 and PIC microcontorller. Multi universe. Point to multipoint. Safe and stable
...training session on the topic. I'm looking for a skilled instructor who can guide me through the following areas: - Basic Concepts and Architecture: I need to understand the foundational principles of Oracle Service Bus (OSB). This includes how it works, its key components, and its role in service-oriented architecture. - Service Development and Deployment: I'm interested in learning how to develop services on OSB and deploy them effectively. This includes hands-on exercises and practical examples to reinforce the learning. - Troubleshooting and Optimization: I want to be able to troubleshoot any potential issues that may arise when working with OSB. Additionally, I'd like to understand how to optimize OSB applications for performance and scalability. The i...
I need a machine learning model developed in Python. This model should be able to evaluate prospective student applications by comparing them to historical data sets. The goal is to classify and sort the new applicants efficiently. Key Requirements: - Develop a classification-based machine learning model in Python - Understand and work with historical data sets to evaluate new student applications - Deploy the model in a web application format for ease of access Ideal Skills and Experience: - Strong background in machine learning and Python - Previous experience in developing classification models - Ability to understand and work with large data sets - Prior experience with deploying machine learning models in web applications
...connection to medical care > Brand Colors: We would like to see a variety of appropriate color options for the brand (see brand theme above), 2 -3 colors per design > The design should be effective in black and white as well as color > The design should be recognizable even at very small sizes > Designs with contrasting elements which lead the eye toward the center of the icon are preferred. > The core design should be in vector format, with .ai (CS3 compatible) and .eps formats required. Other formats are welcome and appreciated. > Fonts used should be identified and either commonly and freely available or be included with the design files. >>> Submissions should be made as soon as possible, <<< as they need to be reviewed by multiple ...
...Android developer, with proven experience in designing and building complex, subscription-based applications. Features: - An intuitive interface facilitating life coaching, psychotherapy and addiction services, coupled with comprehensive course content. - Rich profile pages that offer an in-depth view for each user. - Direct messaging capabilities for seamless communication. Activity Tracking: A core element of this app is the tracking of users’ activities. This entails: - Sleep tracking: To monitor and analyse the user's sleep patterning. - Mental health tracking: A holistic mental health tracker incorporating mood patterns, meditation frequency and daily tasks check-in. Subscription: - A Monthly subscription option is needed, requiring a seamless and secure pa...
As someone looking to significantly drive sales via Facebook, I need a social media marketer with a knack for creating captivating product/service promotional videos. Your task will be to: - Develop a Facebook marketing campaign centered around enticing promotional videos - Ensure the adverts are sales-driven so as to directly impact on the product/service sales Ideal Skills: - Proficient in video creation and editing - Extensive experience in sales-driven social media marketing, particularly Facebook - Creativity and great storytelling to make products/services appealing and engaging.
I'm looking for a developer...capabilities through automated communication. Key Responsibilities: - Integrate Common App with Salesforce and Jenzabar - Implement automated communication features - Ensure smooth and effective application process Specific Requirements: - Previous experience with Salesforce is mandatory - Proven track record of integrating systems - Strong understanding of applicant management systems Your core responsibilities will revolve around implementing and maintaining automated communication features within Salesforce. This includes: - Sending application received confirmations - Updating applicants on their application status - Sending out admission decisions Note: Please include in your application any relevant experience you have with similar syste...
...needs to resonate with the message of trust, innovation, respect, and energy. Key Requirements: - Color: Predominantly blue should be used to represent trust and innovation - Emotion/Message: The logo should emanate trustworthiness intertwined with innovation, respect, professionalism and energy. - Symbols/Icons: The designer is expected to include pertinent symbols or icons that encapsulate the core values of the platform (such as a puzzle pieces, or other matching symbols) Ideal Skills: - Experience in logo and brand identity design. - Ability to translate values and emotions into visual elements. - Strong creative skills and an eye for detail. - Familiarity with current design trends and techniques. You should be prepared to provide a few initial designs for discussion, r...
Company Overview: We specialize in providing innovative automation solutions for small businesses, including CRM, marketing automation, graphic design, and print solutions. Our goal is to streamline operations and drive growth with smart, reliable, and professional tools. Design Guidelines: Concept and Style: Modern and Professional: The logo should reflect a contemporary and professional look. Innovative and Smart: Emphasize the innovative and intelligent nature of our automation solutions. Fluidity and Flow: Incorporate elements that suggest smooth operations and efficiency. Color Palette: Primary colors: Consider using blues, greens, or grays to convey trust, innovation, and reliability. Accent colors: Orange or silver can be used as accent colors to add vibrancy and modernity. Typo...
I'm seeking an experienced researcher to investigate retail displays in Wuhan, China. The project will specifically focus on Talens, a famous art supply brand. The research aims to provide insights into the following aspects: - Brands Available in Displays: The core of this project is to identify and analyze the presence and positioning of Talens within the retail space. - Competitor Analysis: While the primary focus is on Talens, it will be valuable to understand how other brands like Nike, Adidas, and Apple are being displayed in the retail outlets. - Customer Behavior: I'm particularly interested in how the retail displays are shaping customer behavior and purchase decisions. Ideal candidates should have a background in visual merchandising, market research, or...
...responsive and dynamic features. Ideal Skills: * Proficient in WordPress Development, Customizations and Animations with an eye for precision and quality designs * Proficient in Responsive Web Design * Experience in portfolio website creation particularly in Art, Architecture and Object Design Specification: * An initial website is already built. This project requires someone who can re-work and develop customizations based on existing brand guidelines and a list of design specifications, with precision and professionalism – as well as re-work some organizational aspects of the site Functionality: * The website primarily showcases the portfolio. Attractive and seamless presentation is pivotal * Although the main focus is the portfolio, a feature for blogging would be an...
I'm seeking a freelancer to develop a cutting-edge system that will automate payments through the PayPal system. Key Requirements: - The system should completely automate the payment process without any manual intervention. - The integration with the PayPal API is a key requirement, so experience working with this API is crucial. Your main task will be to set up the system to facilitate automated payments by integrating it with the PayPal API. Ideal Skills: - Proficiency in PayPal API. - Prior experience in payment automation development. Experience in creating secure and reliable automated payment systems is a major plus. If you have a track record of developing similar systems in the past, that would be very beneficial.
...designer with proficiency in social media platforms for a project in the agricultural sector. Essential skills for this job include logo design, social media graphics creation, and website design with a primary focus on Instagram. Key Responsibilities: - Design a unique logo that encapsulates our agricultural brand. - Create engaging social media graphics that align with our brand identity. - Develop an aesthetically pleasing website design to complement our social media presence. Social Media Platforms: - Instagram - Facebook - Twitter The major objective of this undertaking is to heighten our brand awareness within the agricultural sector across all our social media platforms. Previous experience in the agricultural sector is an added advantage but not prerequisite. If yo...
I'm in need of an experienced UI/UX Designer for an iOS app dealing with style and fashion. Core Functionality: - The app is essentially a style and fashion app. It uses AI to help people look their best. - The main functionality of the app is to provide a virtual try-on for clothing, offer color matching suggestions and give personalized style recommendations. Target Audience: - The app is designed for both men and women. Ideal Skill Set: - Previous experience working on fashion or style-related apps is a plus. - Knowledge of AI integration for virtual try-on features is highly desirable. - A keen understanding of color theory and style is important. - Ability to create user-friendly and visually appealing interfaces. - Strong communication skills to understand and interpre...
(Business Development Executive) (with good track record) + Must have strong Sales Managerial Experience in any B2B SaaS company OR been as a Sales Partner. + Experience in dealing with B2B + USA Market + Must be interested in taking on new challenges. + Should have hands-on experience. + Only Freelancers are Allowed (No Agencies or No Companies) Fixed Price Project: $3000 / Project
...and engaging online course videos. - Enhancing the footage with animations and effects to maintain student engagement and improve knowledge retention. This will include some on-screen graphics to demonstrate core ideas. Key Deliverables: - Seemlessly edited video files, exported in 4k - Incorporation of captivating animations and effects - All final edits will be due by the end of September 2024. Content will be shot in July (maybe carryover into August) and shared gradually for the editor to work on. Required Skills and Experience: - Proficient in using modern video editing software, preferably Premier Pro (Adobe suite) - Excellent understanding of animations and dynamic effects - Previous experience of editing for e-learning platforms would be advantageous - Stringen...
I am seeking a proficient DevOps engineer with expertise in both AWS and Azure platforms to create a Continuous Integration and Continuous Deployment (CI/CD) pipeline. The main duty will be integrating code changes, individual software modifications, into existing code repositories. Need to create a fully functional pipeline with tech documentation and runbooks .. Key Tasks: - Develop, test, and roll out CI/CD pipeline with supporting infrastructure as Code (Kubernetes, Docker) - Manage code releases and updates with popular orchestration tools like : Jenkins , Ansible Ideal Skills: - Proficiency with AWS and Azure cloud platforms - Strong experience with CI/CD - Adeptness with Python, PowerShell programming or any other popular scripting language This job demands the ...
I'm looking for a machine learning expert who can assist with 3D skeleton extraction and rigging, based on initial performance. Key Requirements: - Experience with 3D skeleton extraction and rigging - Strong background in machine learning Your main task will be to develop and refine machine learning models that can accurately extract and rig 3D skeletons, ensuring that the models are optimized for performance. Your input on how to enhance the performance of existing models will be highly valuable. Please apply if you have a proven track record in machine learning with experience in 3D skeleton extraction and rigging.
I'm in need of a skilled developer to create a file-sharing platform with a focus on user ease and simplicity, much like wedibox. The platform should primarily cater to individuals and feature: - User registration and login: A seamless process that ensures security and privacy for each user. - File sharing and storage: A core feature enabling users to easily upload, share, and manage their files. The storage capacity should be sufficient for individual use. The user interface styling should be modern and minimalist, reflecting the platform's focus on simplicity and ease of use. The ideal freelancer for this project should have a strong background in web development, particularly in creating user-friendly platforms, and an understanding of modern and minimalist design pri...
I am seeking a talented logo designer to create a strong, professional logo for my restoration company. This is a Company called "RDU Restoration" Key Points: - I'm looking for a logo that reflects our company's core values of trustworthiness, reliability, and professionalism. - Our company provides a variety of services, including water damage restoration, fire damage restoration, mold remediation, and smoke damage restoration. - The logo should incorporate colors like Blue, Green, and Red - I'm open to slight variations as well. Ideal Skills and Experience: - Proven experience in logo design, particularly for companies in the service industry would be a huge plus. - Understanding of color psychology and the ability to convey trustworthiness, ...
I urgently need an expert in C# to integrate my Point of Sale/Enterprise Resource Planning (POS/ERP) system with QuickBooks Online. The goal is seamless syncing of different modules, including, but not limited to: - Customer Information - Inventory Status - Purchase History - Sales Records - Products, Categories, etc... Familiarity with QuickBooks Online APIs and proficiency in C# .net Core is imperative for this role. Past experience with similar projects will be highly valued. The timeline is urgent; I need this integration done ASAP. we already have a code we made integration with SAP Business One, we can share this code to have the fastest development, and also we have the code of a previous developer who made of Quickbooks so it would help to see how to integrate
Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.
Description: We are looking for a highly skilled and motivated frontend developer to create a cross-platform desktop application for Windows and MacOS using Electron.js. The application will manage audio, text, and video data, and will utilize websockets for backend data transfer. Key Responsibilities: Develop a responsive and efficient desktop application using , JavaScript, HTML, and CSS. Implement and integrate features to manage audio, text, and video data. Ensure smooth and secure data transfer using websockets. Conduct thorough testing to ensure the application is robust and bug-free. Work closely with stakeholders to gather requirements and iterate based on feedback. Provide comprehensive and clear code documentation. Requirements: Proven experience in developing desktop